Recombinant Human BOC Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BOC Peptides and Proteins

Order Details


    • Catalog Number
      H00091653-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BOC Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 157 of Human BOC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
BOC

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BOC Protein

  • Boc homolog (mouse)
  • BOC
  • brother of CDO
  • Protein BOC

Background

BOC( AAH34614, 1 a.a. - 158 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2429
Species: Mu
Applications: WB, IHC
NBP2-33988
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
AF853
Species: Mu
Applications: WB, IHC
423-F8/CF
Species: Hu, Mu
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00091653-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for BOC Recombinant Protein (H00091653-P01) (0)

There are no publications for BOC Recombinant Protein (H00091653-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BOC Recombinant Protein (H00091653-P01) (0)

There are no reviews for BOC Recombinant Protein (H00091653-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BOC Recombinant Protein (H00091653-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BOC Products

Bioinformatics Tool for BOC Recombinant Protein (H00091653-P01)

Discover related pathways, diseases and genes to BOC Recombinant Protein (H00091653-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BOC Recombinant Protein (H00091653-P01)

Discover more about diseases related to BOC Recombinant Protein (H00091653-P01).
 

Pathways for BOC Recombinant Protein (H00091653-P01)

View related products by pathway.

PTMs for BOC Recombinant Protein (H00091653-P01)

Learn more about PTMs related to BOC Recombinant Protein (H00091653-P01).
 

Research Areas for BOC Recombinant Protein (H00091653-P01)

Find related products by research area.

Blogs on BOC

There are no specific blogs for BOC, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BOC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BOC
Entrez