BNIP3L Antibody (3G2) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related BNIP3L Primary Antibodies

Order Details


    • Catalog Number
      H00000665-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BNIP3L Antibody (3G2) [PerCP] Summary

Immunogen
BNIP3L (NP_004322, 43 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
Specificity
BNIP3L - BCL2/adenovirus E1B 19kDa interacting protein 3-like
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BNIP3L
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BNIP3L Antibody (3G2) [PerCP]

  • Adenovirus E1B19K-binding protein B5
  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A
  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
  • BCL2/adenovirus E1B 19-kd protein-interacting protein 3a
  • BCL2/adenovirus E1B 19kDa interacting protein 3-like
  • BNIP3a
  • BNIP3H
  • BNIP3L
  • Nip3L
  • NIP3-like protein X
  • Nix
  • NIXBCL2/adenovirus E1B 19kD-interacting protein 3-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56150
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81984
Species: Hu
Applications: IHC, IHC-P
BC100-494
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP

Publications for BNIP3L Antibody (H00000665-M01PCP) (0)

There are no publications for BNIP3L Antibody (H00000665-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNIP3L Antibody (H00000665-M01PCP) (0)

There are no reviews for BNIP3L Antibody (H00000665-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BNIP3L Antibody (H00000665-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BNIP3L Products

Bioinformatics Tool for BNIP3L Antibody (H00000665-M01PCP)

Discover related pathways, diseases and genes to BNIP3L Antibody (H00000665-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNIP3L Antibody (H00000665-M01PCP)

Discover more about diseases related to BNIP3L Antibody (H00000665-M01PCP).
 

Pathways for BNIP3L Antibody (H00000665-M01PCP)

View related products by pathway.

PTMs for BNIP3L Antibody (H00000665-M01PCP)

Learn more about PTMs related to BNIP3L Antibody (H00000665-M01PCP).
 

Research Areas for BNIP3L Antibody (H00000665-M01PCP)

Find related products by research area.

Blogs on BNIP3L

There are no specific blogs for BNIP3L, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNIP3L Antibody (3G2) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol BNIP3L
Entrez