Recombinant Human BMP-8a Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BMP-8a Peptides and Proteins

Order Details


    • Catalog Number
      H00353500-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BMP-8a Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 116 of Human BMP8A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNVFKTQTLLCPSGVHSRPEDHDETPFLCSKAQSVTVVAFLVARLLATLATHQMTSHTEGLRKGGGRKDTQLMKGQCSAIKVIFWPGCLPQPRMHSRLHIRSINKGGQLRPTGCNK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BMP8A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BMP-8a Protein

  • BMP-8a
  • bone morphogenetic protein 8a
  • Op2
  • Osteogenic Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
113-BP/CF
Species: Hu
MAB6937
Species: Hu
Applications: WB
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB100-56883
Species: Hu
Applications: IHC, IHC-P
AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
779-G7/CF
Species: Mu
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-89349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF853
Species: Mu
Applications: WB, IHC
H00353500-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for BMP-8a Recombinant Protein (H00353500-P01) (0)

There are no publications for BMP-8a Recombinant Protein (H00353500-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-8a Recombinant Protein (H00353500-P01) (0)

There are no reviews for BMP-8a Recombinant Protein (H00353500-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP-8a Recombinant Protein (H00353500-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BMP-8a Products

Bioinformatics Tool for BMP-8a Recombinant Protein (H00353500-P01)

Discover related pathways, diseases and genes to BMP-8a Recombinant Protein (H00353500-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-8a Recombinant Protein (H00353500-P01)

Discover more about diseases related to BMP-8a Recombinant Protein (H00353500-P01).
 

Pathways for BMP-8a Recombinant Protein (H00353500-P01)

View related products by pathway.

PTMs for BMP-8a Recombinant Protein (H00353500-P01)

Learn more about PTMs related to BMP-8a Recombinant Protein (H00353500-P01).

Blogs on BMP-8a

There are no specific blogs for BMP-8a, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BMP-8a Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BMP8A
Entrez