BMP-2 Antibody

Images

 
Western Blot: BMP-2 Antibody [NBP1-69113] - Rat Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related BMP-2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69113
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BMP-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Bmp2 (bone morphogenetic protein 2) The peptide sequence was selected from the middle region of Bmp2. Peptide sequence EEKPGVSKRHVRISRSLHQDEHSWSQVRPLLVTFGHDGKGHPLHKREKRQ.
Clonality
Polyclonal
Host
Rabbit
Gene
BMP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Bmp2 and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BMP-2 Antibody

  • BMP2
  • BMP-2
  • BMP-2A
  • BMP2ABone morphogenetic protein 2A
  • bone morphogenetic protein 2

Background

Bmp2 induces cartilage and bone formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-69113
Species: Rt
Applications: WB

Publications for BMP-2 Antibody (NBP1-69113) (0)

There are no publications for BMP-2 Antibody (NBP1-69113).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-2 Antibody (NBP1-69113) (0)

There are no reviews for BMP-2 Antibody (NBP1-69113). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP-2 Antibody (NBP1-69113). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in Bone Morphogenic Protein 2 (BMP-2) for clinical trial in humans. I am using this protein in stem cells culture for future use in humans. Do you have BMP-2 in pharma grade that I can use for humans?
    • Our antibodies are for research purposes only unfortunately. I am sorry we cannot be of further help.

Secondary Antibodies

 

Isotype Controls

Additional BMP-2 Products

Bioinformatics Tool for BMP-2 Antibody (NBP1-69113)

Discover related pathways, diseases and genes to BMP-2 Antibody (NBP1-69113). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-2 Antibody (NBP1-69113)

Discover more about diseases related to BMP-2 Antibody (NBP1-69113).
 

Pathways for BMP-2 Antibody (NBP1-69113)

View related products by pathway.

PTMs for BMP-2 Antibody (NBP1-69113)

Learn more about PTMs related to BMP-2 Antibody (NBP1-69113).

Blogs on BMP-2

There are no specific blogs for BMP-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMP-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BMP2
Entrez