Blooms Syndrome Protein Blm Antibody (1E4.) [PerCP]

Images

 

Order Details


    • Catalog Number
      H00000641-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Blooms Syndrome Protein Blm Antibody (1E4.) [PerCP] Summary

Immunogen
BLM (NP_000048 1196 a.a. - 1295 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Specificity
BLM - Bloom syndrome
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BLM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Blooms Syndrome Protein Blm Antibody (1E4.) [PerCP]

  • Bloom syndrome
  • Bloom syndrome, RecQ helicase-like
  • BSBloom syndrome protein
  • DNA helicase, RecQ-like type 2
  • EC 3.6.1
  • EC 3.6.4.12
  • MGC126616
  • MGC131618
  • RecQ protein-like 3
  • RecQ2
  • RECQ2MGC131620
  • RECQL3RECQL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35213
Species: Hu
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF4715
Species: Mu
Applications: WB
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
MAB4077
Species: Hu
Applications: WB, IHC
AF6108
Species: Hu
Applications: IHC
NB100-1720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
H00000641-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP) (0)

There are no publications for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP) (0)

There are no reviews for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Blooms Syndrome Protein Blm Products

Bioinformatics Tool for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP)

Discover related pathways, diseases and genes to Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP)

Discover more about diseases related to Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP).
 

Pathways for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP)

View related products by pathway.

PTMs for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP)

Learn more about PTMs related to Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP).
 

Research Areas for Blooms Syndrome Protein Blm Antibody (H00000641-M01PCP)

Find related products by research area.

Blogs on Blooms Syndrome Protein Blm

There are no specific blogs for Blooms Syndrome Protein Blm, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Blooms Syndrome Protein Blm Antibody (1E4.) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol BLM