Blood group H inhibitor Antibody

Images

 
Western Blot: Blood group H inhibitor Antibody [NBP3-10979] - Western blot analysis of Blood group H inhibitor in Mouse Liver lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Blood group H inhibitor Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Blood group H inhibitor. Peptide sequence ALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAA
Clonality
Polyclonal
Host
Rabbit
Gene
FUT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Blood group H inhibitor Antibody

  • alpha (1,2) fucosyltransferase
  • Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase
  • Blood group H alpha 2-fucosyltransferase
  • EC 2.4.1.69
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
  • Fucosyltransferase 1
  • galactoside 2-alpha-L-fucosyltransferase 1
  • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
  • HHH
  • HSC

Background

Blood group H inhibitor is encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1845-SH/CF
Species: Hu
Applications: BA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-600
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KD, WB
NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-06699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-06699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
255-SC/CF
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
210-TA
Species: Hu
Applications: BA
AF1705
Species: Mu
Applications: IHC, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Blood group H inhibitor Antibody (NBP3-10979) (0)

There are no publications for Blood group H inhibitor Antibody (NBP3-10979).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blood group H inhibitor Antibody (NBP3-10979) (0)

There are no reviews for Blood group H inhibitor Antibody (NBP3-10979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blood group H inhibitor Antibody (NBP3-10979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Blood group H inhibitor Products

Bioinformatics Tool for Blood group H inhibitor Antibody (NBP3-10979)

Discover related pathways, diseases and genes to Blood group H inhibitor Antibody (NBP3-10979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blood group H inhibitor Antibody (NBP3-10979)

Discover more about diseases related to Blood group H inhibitor Antibody (NBP3-10979).
 

Pathways for Blood group H inhibitor Antibody (NBP3-10979)

View related products by pathway.

PTMs for Blood group H inhibitor Antibody (NBP3-10979)

Learn more about PTMs related to Blood group H inhibitor Antibody (NBP3-10979).

Blogs on Blood group H inhibitor

There are no specific blogs for Blood group H inhibitor, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Blood group H inhibitor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT1