Recombinant Human BLOC1S1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related BLOC1S1 Peptides and Proteins

Order Details


    • Catalog Number
      H00002647-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BLOC1S1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-125 of Human BLOC1S1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
BLOC1S1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
40.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BLOC1S1 Protein

  • biogenesis of lysosomal organelles complex-1, subunit 1
  • BLOC subunit 1
  • BLOC-1 subunit 1
  • BLOS1MICoA
  • FLJ39337
  • FLJ97089
  • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 1
  • GCN5 general control of amino-acid synthesis 5-like 1 (yeast)
  • GCN5 general control of amino-acid synthesis 5-like 1
  • GCN5L1biogenesis of lysosome-related organelles complex 1 subunit 1
  • GCN5-like protein 1
  • MGC87455
  • MTA1-interacting coactivator
  • Protein RT14
  • RT14

Background

BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-14357
Species: Hu
Applications: IHC, IHC-P
NBP2-55573
Species: Hu
Applications: ICC/IF
NBP1-92414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66163
Species: Hu
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31848
Species: Hu
Applications: IHC, IHC-P
NBP2-52563
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00011234-P01
Species: Hu
H00055330-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55573
Species: Hu
Applications: ICC/IF
NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00002647-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for BLOC1S1 Recombinant Protein (H00002647-P01) (0)

There are no publications for BLOC1S1 Recombinant Protein (H00002647-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLOC1S1 Recombinant Protein (H00002647-P01) (0)

There are no reviews for BLOC1S1 Recombinant Protein (H00002647-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BLOC1S1 Recombinant Protein (H00002647-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BLOC1S1 Products

Bioinformatics Tool for BLOC1S1 Recombinant Protein (H00002647-P01)

Discover related pathways, diseases and genes to BLOC1S1 Recombinant Protein (H00002647-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLOC1S1 Recombinant Protein (H00002647-P01)

Discover more about diseases related to BLOC1S1 Recombinant Protein (H00002647-P01).
 

Pathways for BLOC1S1 Recombinant Protein (H00002647-P01)

View related products by pathway.

PTMs for BLOC1S1 Recombinant Protein (H00002647-P01)

Learn more about PTMs related to BLOC1S1 Recombinant Protein (H00002647-P01).

Blogs on BLOC1S1

There are no specific blogs for BLOC1S1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BLOC1S1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BLOC1S1