BLIMP1/PRDM1 Antibody (1G9)


Western Blot: BLIMP1/PRDM1 Antibody (1G9) [H00000639-M10] - Analysis of PRDM1 expression in human spleen.
Immunocytochemistry/ Immunofluorescence: BLIMP1/PRDM1 Antibody (1G9) [H00000639-M10] - Analysis of monoclonal antibody to PRDM1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

BLIMP1/PRDM1 Antibody (1G9) Summary

PRDM1 (NP_001189 422 a.a. - 493 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHV
Plasma Cell Marker
PRDM1 - PR domain containing 1, with ZNF domain (1G9)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BLIMP1/PRDM1 Antibody (1G9)

  • Beta-interferon gene positive regulatory domain I-binding factor
  • beta-interferon gene positive-regulatory domain I binding factor
  • BLIMP1
  • BLIMP-1
  • BLIMP1MGC118925
  • blmp-1
  • B-lymphocyte-induced maturation protein 1
  • MGC118922
  • MGC118923
  • Positive regulatory domain I-binding factor 1
  • PR domain containing 1, with ZNF domain
  • PR domain zinc finger protein 1
  • PR domain-containing protein 1
  • PRDI-BF1MGC118924
  • PRDI-binding factor 1
  • PRDI-binding factor-1
  • PRDM1
  • PR-domain zinc finger protein 1
  • ZNFPR1A1


This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready

Publications for BLIMP1/PRDM1 Antibody (H00000639-M10) (0)

There are no publications for BLIMP1/PRDM1 Antibody (H00000639-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLIMP1/PRDM1 Antibody (H00000639-M10) (0)

There are no reviews for BLIMP1/PRDM1 Antibody (H00000639-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BLIMP1/PRDM1 Antibody (H00000639-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BLIMP1/PRDM1 Products

Bioinformatics Tool for BLIMP1/PRDM1 Antibody (H00000639-M10)

Discover related pathways, diseases and genes to BLIMP1/PRDM1 Antibody (H00000639-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLIMP1/PRDM1 Antibody (H00000639-M10)

Discover more about diseases related to BLIMP1/PRDM1 Antibody (H00000639-M10).

Pathways for BLIMP1/PRDM1 Antibody (H00000639-M10)

View related products by pathway.

PTMs for BLIMP1/PRDM1 Antibody (H00000639-M10)

Learn more about PTMs related to BLIMP1/PRDM1 Antibody (H00000639-M10).

Blogs on BLIMP1/PRDM1

There are no specific blogs for BLIMP1/PRDM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BLIMP1/PRDM1 Antibody (1G9) and receive a gift card or discount.


Gene Symbol PRDM1