BLIMP1/PRDM1 Antibody (1F2)

Images

 
Western Blot: BLIMP1/PRDM1 Antibody (1F2) [H00000639-M08] - Analysis of PRDM1 expression in human liver.

Product Details

Summary
Product Discontinued
View other related BLIMP1/PRDM1 Primary Antibodies

Order Details


    • Catalog Number
      H00000639-M08
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BLIMP1/PRDM1 Antibody (1F2) Summary

Immunogen
PRDM1 (NP_001189 422 a.a. - 493 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHV
Marker
Plasma Cell Marker
Specificity
PRDM1 - PR domain containing 1, with ZNF domain (1F2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRDM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BLIMP1/PRDM1 Antibody (1F2)

  • Beta-interferon gene positive regulatory domain I-binding factor
  • beta-interferon gene positive-regulatory domain I binding factor
  • BLIMP1
  • BLIMP-1
  • BLIMP1MGC118925
  • blmp-1
  • B-lymphocyte-induced maturation protein 1
  • MGC118922
  • MGC118923
  • Positive regulatory domain I-binding factor 1
  • PR domain containing 1, with ZNF domain
  • PR domain zinc finger protein 1
  • PR domain-containing protein 1
  • PRDI-BF1MGC118924
  • PRDI-binding factor 1
  • PRDI-binding factor-1
  • PRDM1
  • PR-domain zinc finger protein 1
  • ZNFPR1A1

Background

This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5525
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-89644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
594-ML/CF
Species: Mu
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready

Publications for BLIMP1/PRDM1 Antibody (H00000639-M08) (0)

There are no publications for BLIMP1/PRDM1 Antibody (H00000639-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLIMP1/PRDM1 Antibody (H00000639-M08) (0)

There are no reviews for BLIMP1/PRDM1 Antibody (H00000639-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BLIMP1/PRDM1 Antibody (H00000639-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BLIMP1/PRDM1 Products

Bioinformatics Tool for BLIMP1/PRDM1 Antibody (H00000639-M08)

Discover related pathways, diseases and genes to BLIMP1/PRDM1 Antibody (H00000639-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BLIMP1/PRDM1 Antibody (H00000639-M08)

Discover more about diseases related to BLIMP1/PRDM1 Antibody (H00000639-M08).
 

Pathways for BLIMP1/PRDM1 Antibody (H00000639-M08)

View related products by pathway.

PTMs for BLIMP1/PRDM1 Antibody (H00000639-M08)

Learn more about PTMs related to BLIMP1/PRDM1 Antibody (H00000639-M08).

Blogs on BLIMP1/PRDM1

There are no specific blogs for BLIMP1/PRDM1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BLIMP1/PRDM1 Antibody (1F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM1
Entrez
Uniprot