Recombinant Human Biliverdin Reductase B/BLVRB Protein

Order Details


    • Catalog Number
      H00000645-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Biliverdin Reductase B/BLVRB Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human BLVRB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BLVRB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Biliverdin Reductase B/BLVRB Protein

  • biliverdin reductase B (flavin reductase (NADPH))
  • Biliverdin Reductase B
  • Biliverdin-IX beta-reductase
  • BLVRB
  • BVRB
  • BVR-B
  • EC 1.3.1.24
  • EC 1.5.1.30
  • flavin reductase (NADPH)
  • flavin reductase
  • FLR
  • FLRBVRB
  • FR
  • GHBP
  • Green heme-binding protein
  • MGC117413
  • NADPH-dependent diaphorase
  • NADPH-flavin reductase
  • SDR43U1
  • short chain dehydrogenase/reductase family 43U, member 1

Background

BLVRB - biliverdin reductase B (flavin reductase (NADPH))

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB3307
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01) (0)

There are no publications for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01) (0)

There are no reviews for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Biliverdin Reductase B/BLVRB Products

Bioinformatics Tool for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01)

Discover related pathways, diseases and genes to Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01)

Discover more about diseases related to Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01).
 

Pathways for Biliverdin Reductase B/BLVRB Partial Recombinant Protein (H00000645-Q01)

View related products by pathway.

Blogs on Biliverdin Reductase B/BLVRB

There are no specific blogs for Biliverdin Reductase B/BLVRB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Biliverdin Reductase B/BLVRB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BLVRB
Entrez