BHMT Antibody

Images

 
Western Blot: BHMT Antibody [H00000635-B01P] - Analysis of BHMT expression in transfected 293T cell line by BHMT polyclonal antibody. Lane 1: BHMT transfected lysate(45.00 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BHMT Antibody Summary

Immunogen
BHMT (AAH12616.1, 1 a.a. - 406 a.a.) full-length human protein. MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
BHMT
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BHMT Antibody

  • betaine homocysteine methyltransferase
  • betaine-homocysteine methyltransferase
  • betaine--homocysteine S-methyltransferase 1
  • betaine--homocysteine S-methyltransferase
  • BHMT1
  • EC 2.1.1
  • EC 2.1.1.5

Background

This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
AF7895
Species: Hu
Applications: WB, IHC
NBP1-85826
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF6526
Species: Hu
Applications: WB
AF6466
Species: Hu
Applications: WB
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-23610
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC

Publications for BHMT Antibody (H00000635-B01P) (0)

There are no publications for BHMT Antibody (H00000635-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BHMT Antibody (H00000635-B01P) (0)

There are no reviews for BHMT Antibody (H00000635-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BHMT Antibody (H00000635-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BHMT Products

Bioinformatics Tool for BHMT Antibody (H00000635-B01P)

Discover related pathways, diseases and genes to BHMT Antibody (H00000635-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BHMT Antibody (H00000635-B01P)

Discover more about diseases related to BHMT Antibody (H00000635-B01P).
 

Pathways for BHMT Antibody (H00000635-B01P)

View related products by pathway.

PTMs for BHMT Antibody (H00000635-B01P)

Learn more about PTMs related to BHMT Antibody (H00000635-B01P).

Blogs on BHMT

There are no specific blogs for BHMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BHMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BHMT
Uniprot