beta II Tubulin A Antibody (4B12)

Images

 
Immunohistochemistry-Paraffin: beta II Tubulin A Antibody (4B12) [H00007280-M08] - Analysis of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml

Product Details

Summary
Product Discontinued
View other related beta II Tubulin A Primary Antibodies

Order Details


    • Catalog Number
      H00007280-M08
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

beta II Tubulin A Antibody (4B12) Summary

Immunogen
TUBB2A (AAH01194, 1 a.a. - 445 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TUBB2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for beta II Tubulin A Antibody (4B12)

  • dJ40E16.7
  • TUBB
  • TUBB2
  • TUBB2B
  • tubulin beta-2A chain
  • tubulin, beta 2
  • tubulin, beta 2A
  • tubulin, beta polypeptide 2
  • tubulin, beta polypeptide

Background

Microtubules are essential parts in eukaryotic cell structures, transportation, and mitosis and consists mainly of 2 soluble protein subunits, alpha and beta tubulin. Beta-tubulin binds to alpha tubulin to form tubulin heterodimer which is post-translationally modified (1). The tubulin dimer complex binds to GTP and assembles onto the positive ends of microtubules. After incorporation into the microtubules, bound GTP is hydrolyzed by beta tubulin. The stability of the dimer in the microtubules is depended on presence of beta tubulin, where dimer with GTP bound beta-tubulin is stable to microtubule incorporation (2). Mutation on beta-tubulin has been linked to anti-cancer drug resistance in lung cancers (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1195
Species: Multi
Applications: WB, Simple Western, ICC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
H00023268-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-55090
Species: Hu
Applications: WB, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46245
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00812
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-79815
Species: Hu
Applications: WB
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-14886
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57476
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
H00007280-M08
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for beta II Tubulin A Antibody (H00007280-M08) (0)

There are no publications for beta II Tubulin A Antibody (H00007280-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta II Tubulin A Antibody (H00007280-M08) (0)

There are no reviews for beta II Tubulin A Antibody (H00007280-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta II Tubulin A Antibody (H00007280-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta II Tubulin A Products

Bioinformatics Tool for beta II Tubulin A Antibody (H00007280-M08)

Discover related pathways, diseases and genes to beta II Tubulin A Antibody (H00007280-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta II Tubulin A Antibody (H00007280-M08)

Discover more about diseases related to beta II Tubulin A Antibody (H00007280-M08).
 

Pathways for beta II Tubulin A Antibody (H00007280-M08)

View related products by pathway.

Research Areas for beta II Tubulin A Antibody (H00007280-M08)

Find related products by research area.

Blogs on beta II Tubulin A

There are no specific blogs for beta II Tubulin A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta II Tubulin A Antibody (4B12) and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBB2A
Uniprot