beta-Arrestin 2 Antibody (4D2) [Allophycocyanin]

Images

 

Product Details

Summary
Product Discontinued
View other related beta-Arrestin 2 Primary Antibodies

Order Details


    • Catalog Number
      H00000409-M06APC
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

beta-Arrestin 2 Antibody (4D2) [Allophycocyanin] Summary

Immunogen
ARRB2 (AAH07427, 300 a.a. - 409 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
Specificity
ARRB2 - arrestin, beta 2 (4D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARRB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Rat cross-reactivity determined by WB.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for beta-Arrestin 2 Antibody (4D2) [Allophycocyanin]

  • ARB2
  • ARR2
  • ARRB2
  • arrestin 3
  • Arrestin beta-2
  • arrestin, beta 2
  • BARR2
  • betaArrestin 2
  • beta-Arrestin 2
  • beta-arrestin-2
  • DKFZp686L0365

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24626
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-90008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
H00000409-M06APC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for beta-Arrestin 2 Antibody (H00000409-M06APC) (0)

There are no publications for beta-Arrestin 2 Antibody (H00000409-M06APC).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Arrestin 2 Antibody (H00000409-M06APC) (0)

There are no reviews for beta-Arrestin 2 Antibody (H00000409-M06APC). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for beta-Arrestin 2 Antibody (H00000409-M06APC) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-Arrestin 2 Products

Bioinformatics Tool for beta-Arrestin 2 Antibody (H00000409-M06APC)

Discover related pathways, diseases and genes to beta-Arrestin 2 Antibody (H00000409-M06APC). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Arrestin 2 Antibody (H00000409-M06APC)

Discover more about diseases related to beta-Arrestin 2 Antibody (H00000409-M06APC).
 

Pathways for beta-Arrestin 2 Antibody (H00000409-M06APC)

View related products by pathway.

PTMs for beta-Arrestin 2 Antibody (H00000409-M06APC)

Learn more about PTMs related to beta-Arrestin 2 Antibody (H00000409-M06APC).

Blogs on beta-Arrestin 2

There are no specific blogs for beta-Arrestin 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Arrestin 2 Antibody (4D2) [Allophycocyanin] and receive a gift card or discount.

Bioinformatics

Gene Symbol ARRB2
Entrez