beta-Arrestin 1 Antibody

Images

 
Western Blot: beta-Arrestin 1 Antibody [H00000408-B01P] - Analysis of ARRB1 expression in transfected 293T cell line by ARRB1 polyclonal antibody. Lane 1: ARRB1 transfected lysate(47.10 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

beta-Arrestin 1 Antibody Summary

Immunogen
ARRB1 (NP_004032.2, 1 a.a. - 418 a.a.) full-length human protein. MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ARRB1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for beta-Arrestin 1 Antibody

  • ARB1
  • ARR1
  • ARRB1
  • arrestin 2
  • Arrestin beta-1
  • arrestin, beta 1
  • betaArrestin 1
  • beta-Arrestin 1
  • beta-arrestin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24569
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, Simple Western, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-90008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00000408-B01P
Species: Hu
Applications: WB

Publications for beta-Arrestin 1 Antibody (H00000408-B01P) (0)

There are no publications for beta-Arrestin 1 Antibody (H00000408-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-Arrestin 1 Antibody (H00000408-B01P) (0)

There are no reviews for beta-Arrestin 1 Antibody (H00000408-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-Arrestin 1 Antibody (H00000408-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta-Arrestin 1 Products

Bioinformatics Tool for beta-Arrestin 1 Antibody (H00000408-B01P)

Discover related pathways, diseases and genes to beta-Arrestin 1 Antibody (H00000408-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta-Arrestin 1 Antibody (H00000408-B01P)

Discover more about diseases related to beta-Arrestin 1 Antibody (H00000408-B01P).
 

Pathways for beta-Arrestin 1 Antibody (H00000408-B01P)

View related products by pathway.

PTMs for beta-Arrestin 1 Antibody (H00000408-B01P)

Learn more about PTMs related to beta-Arrestin 1 Antibody (H00000408-B01P).
 

Research Areas for beta-Arrestin 1 Antibody (H00000408-B01P)

Find related products by research area.

Blogs on beta-Arrestin 1

There are no specific blogs for beta-Arrestin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta-Arrestin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARRB1
Entrez
Uniprot