Recombinant Human beta-1,4-Galactosyltransferase 2/B4GalT2 Protein

Order Details


    • Catalog Number
      H00008704-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human beta-1,4-Galactosyltransferase 2/B4GalT2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-306 of Human B4GALT2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPSTQLLAAAAAAATAPGPTPPPLAPGSLRSPVPCPVPRLPRCHPVLTRHLVLRVHRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKVSRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITVDIGRPPSWPPRG

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
B4GALT2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris-HCl, pH 8.0, 10% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human beta-1,4-Galactosyltransferase 2/B4GalT2 Protein

  • B4GalT2
  • B4Gal-T2
  • B4Gal-T3
  • beta-1,4-Galactosyltransferase 2
  • Beta-1,4-GalTase 2
  • beta-4-GalT2
  • beta4Gal-T2
  • beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2
  • EC 2.4.1.-
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
  • UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2
  • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2
  • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2

Background

B4GALT2( AAH02431, 1 a.a. - 307 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88653
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01) (0)

There are no publications for beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01) (0)

There are no reviews for beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional beta-1,4-Galactosyltransferase 2/B4GalT2 Products

Bioinformatics Tool for beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01)

Discover related pathways, diseases and genes to beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein (H00008704-P01)

Find related products by research area.

Blogs on beta-1,4-Galactosyltransferase 2/B4GalT2

There are no specific blogs for beta-1,4-Galactosyltransferase 2/B4GalT2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human beta-1,4-Galactosyltransferase 2/B4GalT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALT2
Entrez