| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acids 361-460 of Human VMD2 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESD |
| Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | BEST1 |
| Dilutions |
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Research Areas for Bestrophin 1 Partial Recombinant Protein (H00007439-Q01)Find related products by research area.
|
|
Vision Infographic: Do you see how I see? Vision involves several parts of the eye processing light which send signals to the brain via the optic nerve to process information. Learn more about the vision process and related ocular proteins in the infographic below. Novus Biological... Read full blog post. |
|
Bestrophin 1: Implications in Progressive Vision Loss The human Bestrophin family has four members, Best1, Best2, Best3 and Best4. These transmembrane proteins can function as chloride channels, and can also regulate calcium channels (1). The Bestrophins all have a conserved domain which begins at the N-... Read full blog post. |
|
"I can see clearly now": Targeting Bestrophin 1 to treat Bestrophinopathies Encoded by the VMD2 gene on chromosome 11q13 Bestrophin 1 is the prototypic member of the RFP family of proteins which are more commonly called "bestrophins". The protein family was originally identified in Caenorhabditis elegans based on a conserved ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BEST1 |