Recombinant Human Beclin 1 Protein

Product Discontinued

Recombinant Human Beclin 1 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 351-450 of Human BECN1 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: BECN1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Beclin 1 Protein

• ATG6 autophagy related 6 homolog
• ATG6
• beclin 1 (coiled-coil, moesin-like BCL2 interacting protein)
• beclin 1 (coiled-coil, moesin-like BCL2-interacting protein)
• Beclin 1
• beclin 1, autophagy related
• beclin1
• beclin-1
• BECN1
• Coiled-coil myosin-like BCL2-interacting protein
• GT197
• Protein GT197
• VPS30

Background

BECN1 - beclin 1 (coiled-coil, myosin-like BCL2 interacting protein)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BECN1