| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acids 351-450 of Human BECN1 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK |
| Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | BECN1 |
| Dilutions |
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Research Areas for Beclin 1 Partial Recombinant Protein (H00008678-Q01)Find related products by research area.
|
|
Autophagy and RAS signaling: Clinical implications By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ... Read full blog post. |
|
Read full blog post. |
|
E-syt in Autophagosome biogenesis: What is the source of it all? By Christina Towers, PhD. Macroautophagy is a cellular recycling process that requires the formation of double membrane structures to engulf and degrade damaged cytoplasmic material. The pathway involves over 20 co... Read full blog post. |
|
Lysosomal Dysfunction is Linked to Exosomal Secretion By Christina Towers, PhD. Lysosomal Dysfunction and DiseaseLysosomes are highly acidic organelles that are critical for cellular function and indispensable for degradative pathways like autophagy and endocytosis.... Read full blog post. |
|
CaMKII stimulates autophagic degradation of 'ID', a new frontier against cancer By Yoskaly Lazo-Fernandez, PhD The field of Cancer Stem Cell (CSC) research has been gaining traction in recent years1. CSCs are a minority group of cells (usually about 1 in 10000) within solid tumors of hematolog... Read full blog post. |
|
Brain size matters: MTOR regulates autophagy and number of cortical interneurons By Jamshed Arslan Pharm.D. Interneurons transmit impulses between other neurons, in part, to facilitate the birth of neurons. Cortical interneurons themselves arise from the progenitors in the ventral telencephalo... Read full blog post. |
|
Autophagy: Pro or Anti-tumorigenic? And the role of epigenetics in this debate By Christina Towers, PhDAutophagy is an evolutionarily conserved process that cells use to break down damaged cytoplasmic constituents in order to fuel cellular metabolism, particularly in instances of stress. This process has been heavily ... Read full blog post. |
|
Key Targets in Apoptosis, Necroptosis, and Autophagy Cell death/recycling pathways such as apoptosis, necroptosis, and autophagy are an integral part of the growth, development, homeostasis as well as the pathophysiology in the life of living organisms. These signaling pathways are highly regulated and ... Read full blog post. |
|
TRIF/TICAM1 and mitochondrial dynamics in the innate immune response TRIF, also known as toll like receptor adaptor molecule 1 or TICAM1, is known for its role in invading foreign pathogens as part of our innate immune response. TRIF/TICAM1 is a TIR-domain adaptor protein (toll/interleukin-1 receptor) that interacts... Read full blog post. |
|
UVRAG - A regulator of membrane trafficking in autophagy and endocytosis UV resistance-associated gene (UVRAG) is a tumor suppressor that is commonly mutated in colon and breast cancer. While UVRAG was discovered for its ability to complement UV sensitivity in xeroderma pigmentosum cells, its main functions are in auto... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BECN1 |