Recombinant Human BDNF Protein

Images

 
SDS-Page: Recombinant Human BDNF Protein [H00000627-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BDNF Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-247 of Human BDNF full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BDNF
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Reviewed Applications
Read 1 Review rated 5
using
H00000627-P01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BDNF Protein

  • Abrineurin
  • ANON2
  • BDNF
  • brain-derived neurotrophic factor
  • BULN2
  • MGC34632
  • neurotrophin

Background

The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
557-NT/CF
Species: Rt
NB110-40561
Species: Hu
Applications: WB, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF5789
Species: Hu, Mu, Rt
Applications: WB
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
H00000627-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for BDNF Recombinant Protein (H00000627-P01) (0)

There are no publications for BDNF Recombinant Protein (H00000627-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for BDNF Recombinant Protein (H00000627-P01) (1) 51

Average Rating: 5
(Based on 1 review)

Reviews using H00000627-P01:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Z Y
07/31/2017
View

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BDNF Recombinant Protein (H00000627-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BDNF Products

Bioinformatics Tool for BDNF Recombinant Protein (H00000627-P01)

Discover related pathways, diseases and genes to BDNF Recombinant Protein (H00000627-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BDNF Recombinant Protein (H00000627-P01)

Discover more about diseases related to BDNF Recombinant Protein (H00000627-P01).
 

Pathways for BDNF Recombinant Protein (H00000627-P01)

View related products by pathway.

PTMs for BDNF Recombinant Protein (H00000627-P01)

Learn more about PTMs related to BDNF Recombinant Protein (H00000627-P01).
 

Research Areas for BDNF Recombinant Protein (H00000627-P01)

Find related products by research area.

Blogs on BDNF.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its...  Read full blog post.

TrkB and Nervous System Function
Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

BDNF Antibodies Aid Research on Alzheimer's Therapies
Brain-derived neurotrophic factor (BDNF) is known to be important for neuronal differentiation, survival, migration and plasticity in both the developing embryo and adult synapses. The BDNF antibody is also proving to be an important tool in Alzheimer...  Read full blog post.

BDNF Antibodies and Synaptic Research
Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophins. During development it regulates the survival and differentiation of neuronal cell populations in the central and peripheral nervous system, while in adult synapse...  Read full blog post.

Save Time & Money with High Quality Sandwich ELISA Kits
Enzyme-linked immunosorbent assay (ELISA) is a widely used technique for detecting concentration of proteins, using enzyme tagged antibodies with which react with dyes to produce a colorimetric or fluorescent signal. Sandwich ELISA takes this one step...  Read full blog post.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
GDNF [Unconjugated]
212-GD-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Z Y
07/31/2017
Application:
Species:

Bioinformatics

Gene Symbol BDNF
Entrez