We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human BDNF Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BDNF Peptides and Proteins

Order Details


    • Catalog Number
      H00000627-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BDNF Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-247 of Human BDNF full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
BDNF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
52.91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
H00000627-P01 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BDNF Protein

  • Abrineurin
  • ANON2
  • BDNF
  • brain-derived neurotrophic factor
  • BULN2
  • MGC34632
  • Neurotrophin

Background

The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

267-N3
Species: Hu
Applications: BA
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
256-GF
Species: Hu
Applications: BA
AF1056
Species: Rt
Applications: IHC, WB
268-N4
Species: Hu
Applications: BA
AF1157
Species: Mu
Applications: IHC, WB
212-GD
Species: Hu
Applications: Bind, BA
H00007170-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
257-NT
Species: Hu
Applications: BA
MAB3468
Species: Hu
Applications: ICC, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
233-FB
Species: Hu
Applications: BA

Publications for BDNF Recombinant Protein (H00000627-P01) (0)

There are no publications for BDNF Recombinant Protein (H00000627-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for BDNF Recombinant Protein (H00000627-P01) (1) 51

Average Rating: 5
(Based on 1 review)

Reviews using H00000627-P01:
Filter by Applications
Stem/Immune cell maintenance or differentiation
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
  5
reviewed by:
Z Y
Stem/Immune cell maintenance or differentiation 07/31/2017
View

Summary

ApplicationStem/Immune cell maintenance or differentiation

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BDNF Recombinant Protein (H00000627-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BDNF Products

Research Areas for BDNF Recombinant Protein (H00000627-P01)

Find related products by research area.

Blogs on BDNF. Showing 1-10 of 11 blog posts - Show all blog posts.


  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ...  Read full blog post.

TrkB and Nervous System Function
Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

BDNF Antibodies Aid Research on Alzheimer's Therapies
Brain-derived neurotrophic factor (BDNF) is known to be important for neuronal differentiation, survival, migration and plasticity in both the developing embryo and adult synapses. The BDNF antibody is also proving to be an important tool in Alzheimer...  Read full blog post.

BDNF Antibodies and Synaptic Research
Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophins. During development it regulates the survival and differentiation of neuronal cell populations in the central and peripheral nervous system, while in adult synapse...  Read full blog post.

Showing 1-10 of 11 blog posts - Show all blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Z Y
07/31/2017
Application: Stem/Immune cell maintenance or differentiation
Species:

Bioinformatics

Gene Symbol BDNF