BCL2L12 Antibody (1B1) [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related BCL2L12 Primary Antibodies

Order Details


    • Catalog Number
      H00083596-M01AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BCL2L12 Antibody (1B1) [Alexa Fluor® 488] Summary

Immunogen
BCL2L12 (AAH07724, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag.RSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPSPPSPEP LARLALAMELSRRVAGLGGTLAGLSVEHVHSFTPWIQAHGGW EGILAVSPVDLNLPLD
Specificity
BCL2L12 - BCL2-like 12 (proline rich)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BCL2L12
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for BCL2L12 Antibody (1B1) [Alexa Fluor® 488]

  • Bcl-2 related proline-rich protein
  • bcl2-L-12
  • BCL2-like 12 (proline rich)
  • bcl-2-like protein 12
  • Bcl-2-related proline-rich protein
  • BPR
  • MGC120313
  • MGC120314
  • MGC120315

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF875
Species: Hu
Applications: WB, IHC
NB100-56115
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC

Publications for BCL2L12 Antibody (H00083596-M01AF488) (0)

There are no publications for BCL2L12 Antibody (H00083596-M01AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL2L12 Antibody (H00083596-M01AF488) (0)

There are no reviews for BCL2L12 Antibody (H00083596-M01AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BCL2L12 Antibody (H00083596-M01AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCL2L12 Products

Bioinformatics Tool for BCL2L12 Antibody (H00083596-M01AF488)

Discover related pathways, diseases and genes to BCL2L12 Antibody (H00083596-M01AF488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL2L12 Antibody (H00083596-M01AF488)

Discover more about diseases related to BCL2L12 Antibody (H00083596-M01AF488).
 

Pathways for BCL2L12 Antibody (H00083596-M01AF488)

View related products by pathway.

PTMs for BCL2L12 Antibody (H00083596-M01AF488)

Learn more about PTMs related to BCL2L12 Antibody (H00083596-M01AF488).
 

Research Areas for BCL2L12 Antibody (H00083596-M01AF488)

Find related products by research area.

Blogs on BCL2L12

There are no specific blogs for BCL2L12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCL2L12 Antibody (1B1) [Alexa Fluor® 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L12