Recombinant Human BCKDHA Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BCKDHA Peptides and Proteins

Order Details


    • Catalog Number
      H00000593-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BCKDHA Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-99 of Human BCKDHA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BCKDHA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BCKDHA Protein

  • 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
  • BCKDE1A
  • BCKDH E1-alpha
  • branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urinedisease)
  • branched chain keto acid dehydrogenase E1, alpha polypeptide
  • Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain
  • EC 1.2.4.4,2-oxoisovalerate dehydrogenase (lipoamide)
  • FLJ45695
  • MSU
  • MSUD1
  • OVD1A

Background

BCKDHA - branched chain keto acid dehydrogenase E1, alpha polypeptide (maple syrup urine disease)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-29984
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for BCKDHA Partial Recombinant Protein (H00000593-Q01) (0)

There are no publications for BCKDHA Partial Recombinant Protein (H00000593-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCKDHA Partial Recombinant Protein (H00000593-Q01) (0)

There are no reviews for BCKDHA Partial Recombinant Protein (H00000593-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCKDHA Partial Recombinant Protein (H00000593-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BCKDHA Products

Bioinformatics Tool for BCKDHA Partial Recombinant Protein (H00000593-Q01)

Discover related pathways, diseases and genes to BCKDHA Partial Recombinant Protein (H00000593-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCKDHA Partial Recombinant Protein (H00000593-Q01)

Discover more about diseases related to BCKDHA Partial Recombinant Protein (H00000593-Q01).
 

Pathways for BCKDHA Partial Recombinant Protein (H00000593-Q01)

View related products by pathway.

Blogs on BCKDHA

There are no specific blogs for BCKDHA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BCKDHA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BCKDHA