BBS10 Antibody

Images

 
Immunohistochemistry-Paraffin: BBS10 Antibody [NBP2-32399] - Staining of human fallopian tube shows strong positivity in cilia.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BBS10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BBS10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BBS10 Protein (NBP2-32399PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BBS10 Antibody

  • Bardet-Biedl syndrome 10 protein
  • Bardet-Biedl syndrome 10
  • FLJ23560C12orf58chromosome 12 open reading frame 58

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-88688
Species: Hu
Applications: IHC, IHC-P
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P

Publications for BBS10 Antibody (NBP2-32399) (0)

There are no publications for BBS10 Antibody (NBP2-32399).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBS10 Antibody (NBP2-32399) (0)

There are no reviews for BBS10 Antibody (NBP2-32399). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BBS10 Antibody (NBP2-32399) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BBS10 Products

Bioinformatics Tool for BBS10 Antibody (NBP2-32399)

Discover related pathways, diseases and genes to BBS10 Antibody (NBP2-32399). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS10 Antibody (NBP2-32399)

Discover more about diseases related to BBS10 Antibody (NBP2-32399).
 

Pathways for BBS10 Antibody (NBP2-32399)

View related products by pathway.

Research Areas for BBS10 Antibody (NBP2-32399)

Find related products by research area.

Blogs on BBS10

There are no specific blogs for BBS10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BBS10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BBS10