Recombinant Human BASP1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BASP1 Peptides and Proteins

Order Details


    • Catalog Number
      H00010409-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BASP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-227 of Human BASP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEPQAPAEPAEAKEGKEKPDQDAEGKAEEKEGEKDAAAAKEEAPKAEPEKTEGAAEAKAEPPKAPEQEQAAPGPLRGGEAPKAAEAAAGPRPRAAPAAGEEPSKEEGEPKKTEAPAAPAAQETKSDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPKAQGPAASAEEPKPVEAPAANSDQTVTVKE

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
BASP1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BASP1 Protein

  • BASP1
  • brain abundant, membrane attached signal protein 1,22 kDa neuronal tissue-enriched acidic protein
  • brain acid-soluble protein 1
  • CAP23
  • CAP-23
  • CAP23brain acid soluble protein 1
  • NAP22
  • NAP-22
  • NAP22MGC8555
  • Neuronal axonal membrane protein NAP-22
  • neuronal tissue-enriched acidic protein

Background

This gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in proteins with high turnover rates. Immunological characteristics of this protein are species specific. This protein also undergoes N-terminal myristoylation. BASP1( NP_006308, 1 a.a. - 228 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-49461
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, In vivo
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for BASP1 Recombinant Protein (H00010409-P01) (0)

There are no publications for BASP1 Recombinant Protein (H00010409-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BASP1 Recombinant Protein (H00010409-P01) (0)

There are no reviews for BASP1 Recombinant Protein (H00010409-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BASP1 Recombinant Protein (H00010409-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BASP1 Products

BASP1 H00010409-P01

Bioinformatics Tool for BASP1 Recombinant Protein (H00010409-P01)

Discover related pathways, diseases and genes to BASP1 Recombinant Protein (H00010409-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BASP1 Recombinant Protein (H00010409-P01)

Discover more about diseases related to BASP1 Recombinant Protein (H00010409-P01).
 

Pathways for BASP1 Recombinant Protein (H00010409-P01)

View related products by pathway.

PTMs for BASP1 Recombinant Protein (H00010409-P01)

Learn more about PTMs related to BASP1 Recombinant Protein (H00010409-P01).

Blogs on BASP1

There are no specific blogs for BASP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BASP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BASP1
Entrez