BARD1 Antibody (2A11) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related BARD1 Primary Antibodies

Order Details


    • Catalog Number
      H00000580-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BARD1 Antibody (2A11) [PerCP] Summary

Immunogen
BARD1 (NP_000456 658 a.a. - 757 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK
Specificity
BARD1 - BRCA1 associated RING domain 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BARD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BARD1 Antibody (2A11) [PerCP]

  • BARD-1
  • BRCA1 associated RING domain 1
  • BRCA1-associated RING domain gene 1
  • BRCA1-associated RING domain protein 1
  • EC 6.3.2.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
MAB2476
Species: Hu
Applications: WB, IHC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for BARD1 Antibody (H00000580-M01PCP) (0)

There are no publications for BARD1 Antibody (H00000580-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BARD1 Antibody (H00000580-M01PCP) (0)

There are no reviews for BARD1 Antibody (H00000580-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BARD1 Antibody (H00000580-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BARD1 Products

BARD1 H00000580-M01PCP

Bioinformatics Tool for BARD1 Antibody (H00000580-M01PCP)

Discover related pathways, diseases and genes to BARD1 Antibody (H00000580-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BARD1 Antibody (H00000580-M01PCP)

Discover more about diseases related to BARD1 Antibody (H00000580-M01PCP).
 

Pathways for BARD1 Antibody (H00000580-M01PCP)

View related products by pathway.

PTMs for BARD1 Antibody (H00000580-M01PCP)

Learn more about PTMs related to BARD1 Antibody (H00000580-M01PCP).
 

Research Areas for BARD1 Antibody (H00000580-M01PCP)

Find related products by research area.

Blogs on BARD1

There are no specific blogs for BARD1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BARD1 Antibody (2A11) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol BARD1