Recombinant Human BAP1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BAP1 Peptides and Proteins

Order Details


    • Catalog Number
      H00008314-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BAP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 61-160 of Human BAP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
BAP1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAP1 Protein

  • BAP1
  • BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
  • BRCA1-associated protein 1
  • Cerebral protein 6
  • cerebral protein-13
  • Cerebral Protein-6
  • DKFZp686N04275
  • EC 3.4.19.12
  • FLJ35406
  • FLJ37180
  • hucep-6
  • KIAA0272HUCEP-13
  • ubiquitin carboxyl-terminal hydrolase BAP1
  • ubiquitin carboxy-terminal hydrolase
  • UCHL2

Background

BAP1 - BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-84309
Species: Hu
Applications: WB, IHC, IHC-P
H00171023-M05
Species: Hu
Applications: WB, ELISA
NB100-319
Species: Hu
Applications: WB, IP, PLA
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57955
Species: Hu
Applications: WB, ICC/IF
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00008314-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for BAP1 Partial Recombinant Protein (H00008314-Q01) (0)

There are no publications for BAP1 Partial Recombinant Protein (H00008314-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAP1 Partial Recombinant Protein (H00008314-Q01) (0)

There are no reviews for BAP1 Partial Recombinant Protein (H00008314-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAP1 Partial Recombinant Protein (H00008314-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAP1 Products

Bioinformatics Tool for BAP1 Partial Recombinant Protein (H00008314-Q01)

Discover related pathways, diseases and genes to BAP1 Partial Recombinant Protein (H00008314-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAP1 Partial Recombinant Protein (H00008314-Q01)

Discover more about diseases related to BAP1 Partial Recombinant Protein (H00008314-Q01).
 

Pathways for BAP1 Partial Recombinant Protein (H00008314-Q01)

View related products by pathway.

PTMs for BAP1 Partial Recombinant Protein (H00008314-Q01)

Learn more about PTMs related to BAP1 Partial Recombinant Protein (H00008314-Q01).
 

Research Areas for BAP1 Partial Recombinant Protein (H00008314-Q01)

Find related products by research area.

Blogs on BAP1

There are no specific blogs for BAP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAP1
Entrez