BANF1 Antibody (M2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related BANF1 Primary Antibodies

Order Details


    • Catalog Number
      H00008815-M07G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BANF1 Antibody (M2) [DyLight 488] Summary

Immunogen
BANF1 (AAH05942, 1 a.a. - 89 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Specificity
BANF1 - barrier to autointegration factor 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BANF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BANF1 Antibody (M2) [DyLight 488]

  • BAFMGC111161
  • barrier to autointegration factor 1
  • barrier-to-autointegration factor
  • BCRG1
  • BCRP1
  • Breakpoint cluster region protein 1
  • D14S1460

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for BANF1 Antibody (H00008815-M07G) (0)

There are no publications for BANF1 Antibody (H00008815-M07G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BANF1 Antibody (H00008815-M07G) (0)

There are no reviews for BANF1 Antibody (H00008815-M07G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BANF1 Antibody (H00008815-M07G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BANF1 Products

Bioinformatics Tool for BANF1 Antibody (H00008815-M07G)

Discover related pathways, diseases and genes to BANF1 Antibody (H00008815-M07G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BANF1 Antibody (H00008815-M07G)

Discover more about diseases related to BANF1 Antibody (H00008815-M07G).
 

Pathways for BANF1 Antibody (H00008815-M07G)

View related products by pathway.

PTMs for BANF1 Antibody (H00008815-M07G)

Learn more about PTMs related to BANF1 Antibody (H00008815-M07G).
 

Research Areas for BANF1 Antibody (H00008815-M07G)

Find related products by research area.

Blogs on BANF1

There are no specific blogs for BANF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BANF1 Antibody (M2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol BANF1