Recombinant Human Band 3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Band 3 Protein [H00006521-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human Band 3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 261-360 of Human Band 3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC4A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Band 3 GST (N-Term) Protein

  • AE 1
  • AE1MGC126619
  • Anion exchange protein 1
  • Anion exchanger 1
  • band 3 anion transport protein
  • BND3
  • CD233 antigen
  • CD233
  • DI
  • EMPB3
  • EPB3MGC126623
  • erythrocyte membrane protein band 3
  • erythroid anion exchange protein
  • FR
  • Froese blood group
  • MGC116750
  • MGC116753
  • RTA1A
  • Solute carrier family 4 member 1
  • solute carrier family 4, anion exchanger, member 1 (erythrocyte membraneprotein band 3, Diego blood group)
  • solute carrier family 4, anion exchanger, number 1
  • SW
  • Swann blood group
  • Waldner blood group
  • WD
  • WD1
  • WR
  • Wright blood group

Background

The protein encoded by this gene is part of the anion exchanger (AE) family and is expressed in the erythrocyte plasma membrane, where it functions as a chloride/bicarbonate exchanger involved in carbon dioxide transport from tissues to lungs. The protein comprises two domains that are structurally and functionally distinct. The N-terminal 40kDa domain is located in the cytoplasm and acts as an attachment site for the red cell skeleton by binding ankyrin. The glycosylated C-terminal membrane-associated domain contains 12-14 membrane spanning segments and carries out the stilbene disulphonate-sensitive exchange transport of anions. The cytoplasmic tail at the extreme C-terminus of the membrane domain binds carbonic anhydrase II. The encoded protein associates with the red cell membrane protein glycophorin A and this association promotes the correct folding and translocation of the exchanger. This protein is predominantly dimeric but forms tetramers in the presence of ankyrin. Many mutations in this gene are known in man, and these mutations can lead to two types of disease: destabilization of red cell membrane leading to hereditary spherocytosis, and defective kidney acid secretion leading to distal renal tubular acidosis. Other mutations that do not give rise to disease result in novel blood group antigens, which form the Diego blood group system. Southeast Asian ovalocytosis (SAO, Melanesian ovalocytosis) results from the heterozygous presence of a deletion in the encoded protein and is common in areas where Plasmodium falciparum malaria is endemic. One null mutation in this gene is known, resulting in very severe anemia and nephrocalcinosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-83556
Species: Hu
Applications: WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
664-LI
Species: Hu
Applications: BA
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-47405
Species: Hu
Applications: IHC,  IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-44814
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-84854
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for Band 3 Partial Recombinant Protein (H00006521-Q01) (0)

There are no publications for Band 3 Partial Recombinant Protein (H00006521-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Band 3 Partial Recombinant Protein (H00006521-Q01) (0)

There are no reviews for Band 3 Partial Recombinant Protein (H00006521-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Band 3 Partial Recombinant Protein (H00006521-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Band 3 Products

Research Areas for Band 3 Partial Recombinant Protein (H00006521-Q01)

Find related products by research area.

Blogs on Band 3

There are no specific blogs for Band 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Band 3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC4A1