Recombinant Human BAMBI/NMA Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BAMBI/NMA Peptides and Proteins

Order Details


    • Catalog Number
      H00025805-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BAMBI/NMA Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-260 of Human BAMBI full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
BAMBI

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAMBI/NMA Protein

  • BAMBI
  • BMP and activin membrane-bound inhibitor homolog (Xenopus laevis)
  • BMP and activin membrane-bound inhibitor homolog
  • NMA
  • NMANon-metastatic gene A protein
  • Putative transmembrane protein NMA

Background

BAMBI( AAH19252, 1 a.a. - 261 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-26612
Species: Hu
Applications: IP (-), WB

Publications for BAMBI/NMA Recombinant Protein (H00025805-P01) (0)

There are no publications for BAMBI/NMA Recombinant Protein (H00025805-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAMBI/NMA Recombinant Protein (H00025805-P01) (0)

There are no reviews for BAMBI/NMA Recombinant Protein (H00025805-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAMBI/NMA Recombinant Protein (H00025805-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAMBI/NMA Products

Bioinformatics Tool for BAMBI/NMA Recombinant Protein (H00025805-P01)

Discover related pathways, diseases and genes to BAMBI/NMA Recombinant Protein (H00025805-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAMBI/NMA Recombinant Protein (H00025805-P01)

Discover more about diseases related to BAMBI/NMA Recombinant Protein (H00025805-P01).
 

Pathways for BAMBI/NMA Recombinant Protein (H00025805-P01)

View related products by pathway.

PTMs for BAMBI/NMA Recombinant Protein (H00025805-P01)

Learn more about PTMs related to BAMBI/NMA Recombinant Protein (H00025805-P01).

Blogs on BAMBI/NMA

There are no specific blogs for BAMBI/NMA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAMBI/NMA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAMBI
Entrez