Recombinant Human BAK Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BAK Peptides and Proteins

Order Details


    • Catalog Number
      H00000578-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BAK Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-112 of Human BAK1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

Protein/Peptide Type
Partial Recombinant Protein
Gene
BAK1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAK Protein

  • Apoptosis regulator BAK
  • BAK
  • BAK1
  • BAK-LIKE
  • BAKMGC3887
  • BCL2-antagonist/killer 1
  • BCL2L7
  • bcl2-L-7
  • BCL2L7bcl-2 homologous antagonist/killer
  • BCL2-like 7 protein
  • Bcl-2-like protein 7
  • CDN1
  • MGC117255
  • pro-apoptotic protein BAK

Background

BAK1 - BCL2-antagonist/killer 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for BAK Partial Recombinant Protein (H00000578-Q01) (0)

There are no publications for BAK Partial Recombinant Protein (H00000578-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAK Partial Recombinant Protein (H00000578-Q01) (0)

There are no reviews for BAK Partial Recombinant Protein (H00000578-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAK Partial Recombinant Protein (H00000578-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAK Products

Bioinformatics Tool for BAK Partial Recombinant Protein (H00000578-Q01)

Discover related pathways, diseases and genes to BAK Partial Recombinant Protein (H00000578-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAK Partial Recombinant Protein (H00000578-Q01)

Discover more about diseases related to BAK Partial Recombinant Protein (H00000578-Q01).
 

Pathways for BAK Partial Recombinant Protein (H00000578-Q01)

View related products by pathway.

PTMs for BAK Partial Recombinant Protein (H00000578-Q01)

Learn more about PTMs related to BAK Partial Recombinant Protein (H00000578-Q01).
 

Research Areas for BAK Partial Recombinant Protein (H00000578-Q01)

Find related products by research area.

Blogs on BAK.

IRE1 alpha dependent apoptotic-signaling pathway
Despite in depth characterization of the role of IRE1 alpha (inositol-requiring enzyme 1 alpha) in activating the unfolded protein response (UPR) in the ER - little is known about the molecular mechanisms by which this ER protein has shown to reg...  Read full blog post.

p53 - Investigating an important tumor suppressor
p53 is a tumor suppressor that has a central role in regulating cell cycle arrest, DNA repair, and apoptosis. p53 is widely studied for its role in cancer and is mutated or altered in more than half of all cancers (1). This widespread role in tumor...  Read full blog post.

Dynamin-related Protein 1 (DRP1) in Mitochondria and Apoptosis.
Dynamin-related Protein 1 (DRP1) is known to function in mitochondrial and peroxisomal division and mediate membrane fission through oligomerization into ring-like structure and sever the mitochondrial membrane, through a GTP hydrolysis-dependent mech...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAK1
Entrez