Recombinant Human BAI2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BAI2 Peptides and Proteins

Order Details


    • Catalog Number
      H00000576-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BAI2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-87 of Human BAI2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BAI2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAI2 Protein

  • BAI2
  • brain-specific angiogenesis inhibitor 2
  • Brain-specific angiongenesis inhibitor-2

Background

BAI2 - brain-specific angiogenesis inhibitor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-81586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NLS979
Species: Hu, Mu, Rt, Bt, Bv, Ca, Ch, Eq, Mk, Pm, Rb
Applications: IHC, IHC-P
NBP2-38016
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NLS418
Species: Hu
Applications: IHC-P
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
H00442206-R02
Species: Hu
MAB8864
Species: Hu
Applications: IHC
H00441931-R02
Species: Hu
AF3145
Species: Hu
Applications: WB
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-88956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BAI2 Partial Recombinant Protein (H00000576-Q01) (0)

There are no publications for BAI2 Partial Recombinant Protein (H00000576-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAI2 Partial Recombinant Protein (H00000576-Q01) (0)

There are no reviews for BAI2 Partial Recombinant Protein (H00000576-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAI2 Partial Recombinant Protein (H00000576-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAI2 Products

Bioinformatics Tool for BAI2 Partial Recombinant Protein (H00000576-Q01)

Discover related pathways, diseases and genes to BAI2 Partial Recombinant Protein (H00000576-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAI2 Partial Recombinant Protein (H00000576-Q01)

Discover more about diseases related to BAI2 Partial Recombinant Protein (H00000576-Q01).
 

Pathways for BAI2 Partial Recombinant Protein (H00000576-Q01)

View related products by pathway.

PTMs for BAI2 Partial Recombinant Protein (H00000576-Q01)

Learn more about PTMs related to BAI2 Partial Recombinant Protein (H00000576-Q01).
 

Research Areas for BAI2 Partial Recombinant Protein (H00000576-Q01)

Find related products by research area.

Blogs on BAI2

There are no specific blogs for BAI2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAI2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAI2
Entrez