BAG3 Antibody

Images

 
Western Blot: BAG3 Antibody [NBP1-70418] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAG3 Antibody Summary

Immunogen
Synthetic peptides corresponding to BAG3(BCL2-associated athanogene 3) The peptide sequence was selected from the middle region of BAG3. Peptide sequence NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BAG3 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BAG3 Antibody

  • BAG family molecular chaperone regulator 3
  • BAG-3
  • BAG-family molecular chaperone regulator-3
  • Bcl-2-associated athanogene 3
  • BCL2-associated athanogene 3
  • BCL2-binding athanogene 3
  • Bcl-2-binding protein Bis
  • BIS
  • CAIR-1
  • Docking protein CAIR-1
  • MGC104307

Background

BAG3 inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release. BAG3 has anti-apoptotic activity.BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NB100-56696
Species: Hu
Applications: WB, Flow
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-70418
Species: Hu
Applications: WB

Publications for BAG3 Antibody (NBP1-70418) (0)

There are no publications for BAG3 Antibody (NBP1-70418).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAG3 Antibody (NBP1-70418) (0)

There are no reviews for BAG3 Antibody (NBP1-70418). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAG3 Antibody (NBP1-70418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAG3 Products

Bioinformatics Tool for BAG3 Antibody (NBP1-70418)

Discover related pathways, diseases and genes to BAG3 Antibody (NBP1-70418). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAG3 Antibody (NBP1-70418)

Discover more about diseases related to BAG3 Antibody (NBP1-70418).
 

Pathways for BAG3 Antibody (NBP1-70418)

View related products by pathway.

PTMs for BAG3 Antibody (NBP1-70418)

Learn more about PTMs related to BAG3 Antibody (NBP1-70418).

Blogs on BAG3

There are no specific blogs for BAG3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAG3