Bag-1 Antibody (4C10)

Images

 
Western Blot: Bag-1 Antibody (4C10) [H00000573-M04] - Analysis of BAG1 expression in HL-60 (Cat # L014V1).
Immunohistochemistry-Paraffin: Bag-1 Antibody (4C10) [H00000573-M04] - Analysis of monoclonal antibody to BAG1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml
ELISA: Bag-1 Antibody (4C10) [H00000573-M04] - Detection limit for recombinant GST tagged BAG1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Bag-1 Antibody (4C10) Summary

Immunogen
BAG1 (NP_004314 241 a.a. - 345 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE
Specificity
BAG1 - BCL2-associated athanogene
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
BAG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Bag-1 Antibody (4C10)

  • BAG family molecular chaperone regulator 1
  • Bag1
  • Bag-1
  • Bcl-2 associating athanogene-1 protein
  • Bcl-2-associated athanogene 1
  • BCL2-associated athanogene
  • Bcl-2-binding protein
  • glucocortoid receptor-associated protein RAP46,46-KD
  • HAP
  • RAP46

Background

The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. At least three protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) start site, and alternative, downstream, AUG translation initiation sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19533
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for Bag-1 Antibody (H00000573-M04) (0)

There are no publications for Bag-1 Antibody (H00000573-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bag-1 Antibody (H00000573-M04) (0)

There are no reviews for Bag-1 Antibody (H00000573-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Bag-1 Antibody (H00000573-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bag-1 Products

Bioinformatics Tool for Bag-1 Antibody (H00000573-M04)

Discover related pathways, diseases and genes to Bag-1 Antibody (H00000573-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bag-1 Antibody (H00000573-M04)

Discover more about diseases related to Bag-1 Antibody (H00000573-M04).
 

Pathways for Bag-1 Antibody (H00000573-M04)

View related products by pathway.

PTMs for Bag-1 Antibody (H00000573-M04)

Learn more about PTMs related to Bag-1 Antibody (H00000573-M04).
 

Research Areas for Bag-1 Antibody (H00000573-M04)

Find related products by research area.

Blogs on Bag-1.

BAG3 - Hsp70 is my friend!
The BAG proteins are a large family of chaperone regulators governing a wide range of cell processes such as proliferation, survival, stress response, tumorigenesis, neuronal differentiation, growth arrest and apoptosis as reviewed in Takayama et al1....  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bag-1 Antibody (4C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol BAG1
Entrez
OMIM
Uniprot