BAFF Receptor Antibody

Images

 
Western Blot: BAFF Receptor Antibody [NBP1-90011] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: BAFF Receptor Antibody [NBP1-90011] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAFF Receptor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFRSF13C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BAFF Receptor Recombinant Protein Antigen (NBP1-90011PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAFF Receptor Antibody

  • B cell-activating factor receptor
  • BAFF receptor
  • BAFF-R
  • BAFFRMGC138235
  • B-cell-activating factor receptor
  • BLyS receptor 3
  • BR3
  • CD268 antigen
  • CD268
  • CVID4
  • tumor necrosis factor receptor superfamily member 13C
  • tumor necrosis factor receptor superfamily, member 13C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56516
Species: Hu, Mu
Applications: WB, IHC
NBP1-97637
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BAFF Receptor Antibody (NBP1-90011) (0)

There are no publications for BAFF Receptor Antibody (NBP1-90011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAFF Receptor Antibody (NBP1-90011) (0)

There are no reviews for BAFF Receptor Antibody (NBP1-90011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAFF Receptor Antibody (NBP1-90011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAFF Receptor Products

Bioinformatics Tool for BAFF Receptor Antibody (NBP1-90011)

Discover related pathways, diseases and genes to BAFF Receptor Antibody (NBP1-90011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAFF Receptor Antibody (NBP1-90011)

Discover more about diseases related to BAFF Receptor Antibody (NBP1-90011).
 

Pathways for BAFF Receptor Antibody (NBP1-90011)

View related products by pathway.

PTMs for BAFF Receptor Antibody (NBP1-90011)

Learn more about PTMs related to BAFF Receptor Antibody (NBP1-90011).
 

Research Areas for BAFF Receptor Antibody (NBP1-90011)

Find related products by research area.

Blogs on BAFF Receptor

There are no specific blogs for BAFF Receptor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAFF Receptor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF13C