BACH1 Recombinant Protein Antigen

Images

 
There are currently no images for BACH1 Recombinant Protein Antigen (NBP2-55113PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BACH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BACH1.

Source: E. coli

Amino Acid Sequence: LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BACH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55113.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BACH1 Recombinant Protein Antigen

  • BACH1
  • basic region leucine zipper transcriptional regulator BACH1
  • BTB and CNC homolog 1
  • BTB and CNC homology 1, basic leucine zipper transcription factor 1
  • BTB
  • HA2303
  • transcription regulator protein BACH1
  • transcription regulator protein10BACH-1

Background

BACH1 (also known as BRCA1 interacting protein C-terminal helicase 1, BRCA1-interacting protein 1 and BRCA1-associated C-terminal helicase 1) is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). The BACH1 gene may be a target of germline cancer-inducing mutations. BACH1 is localized within the nucleus and functions as a DNA-dependent ATPase and 5' to 3' DNA helicase. Two isoforms have been identified for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PLA, Simple Western, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-92139
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-82580
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NB100-79809
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP
NBP2-14345
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-97766
Species: Hu
Applications: PEP-ELISA, WB
NB100-60439
Species: Hu, Mu
Applications: IP, WB
NBP1-89929
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB3809
Species: Hu, Mu
Applications: WB
NB100-2564
Species: Hu
Applications: WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB

Publications for BACH1 Recombinant Protein Antigen (NBP2-55113PEP) (0)

There are no publications for BACH1 Recombinant Protein Antigen (NBP2-55113PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BACH1 Recombinant Protein Antigen (NBP2-55113PEP) (0)

There are no reviews for BACH1 Recombinant Protein Antigen (NBP2-55113PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BACH1 Recombinant Protein Antigen (NBP2-55113PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BACH1 Products

Research Areas for BACH1 Recombinant Protein Antigen (NBP2-55113PEP)

Find related products by research area.

Blogs on BACH1

There are no specific blogs for BACH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BACH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BACH1