BACH1 Antibody

Images

 
Western Blot: BACH1 Antibody [NBP1-88722] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: BACH1 Antibody [NBP1-88722] - Staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BACH1 Antibody [NBP1-88722] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: BACH1 Antibody [NBP1-88722] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
Simple Western: BACH1 Antibody [NBP1-88722] - Simple Western lane view shows a specific band for BACH1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more

Product Details

Summary
Product Discontinued
View other related BACH1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88722
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BACH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESMCLEKDAALA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BACH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Publications
Read Publications using NBP1-88722.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24395801)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BACH1 Antibody

  • BACH1
  • basic region leucine zipper transcriptional regulator BACH1
  • BTB and CNC homolog 1
  • BTB and CNC homology 1, basic leucine zipper transcription factor 1
  • BTB
  • HA2303
  • transcription regulator protein BACH1
  • transcription regulator protein10BACH-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP2-14345
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
21340002
Species: Hu
Applications: ELISA
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB3809
Species: Hu, Mu
Applications: WB
NB100-2564
Species: Hu
Applications: WB
NB100-56552
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for BACH1 Antibody (NBP1-88722)(4)

Reviews for BACH1 Antibody (NBP1-88722) (0)

There are no reviews for BACH1 Antibody (NBP1-88722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BACH1 Antibody (NBP1-88722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BACH1 Products

Bioinformatics Tool for BACH1 Antibody (NBP1-88722)

Discover related pathways, diseases and genes to BACH1 Antibody (NBP1-88722). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BACH1 Antibody (NBP1-88722)

Discover more about diseases related to BACH1 Antibody (NBP1-88722).
 

Pathways for BACH1 Antibody (NBP1-88722)

View related products by pathway.

PTMs for BACH1 Antibody (NBP1-88722)

Learn more about PTMs related to BACH1 Antibody (NBP1-88722).
 

Research Areas for BACH1 Antibody (NBP1-88722)

Find related products by research area.

Blogs on BACH1

There are no specific blogs for BACH1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BACH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BACH1
Entrez