Recombinant Human BACE-2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BACE-2 Peptides and Proteins

Order Details


    • Catalog Number
      H00025825-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BACE-2 Protein Summary

Description
BACE-2 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYR
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
BACE2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BACE-2 Protein

  • AEPLC
  • Asp 1
  • ASP1
  • ASP21
  • Aspartic-like protease 56 kDa
  • Aspartyl protease 1
  • BACE2
  • BACE-2
  • beta secretase 2
  • beta-secretase 2
  • beta-site amyloid beta A4 precursor protein-cleaving enzyme 2
  • Beta-site amyloid precursor protein cleaving enzyme 2
  • Beta-site APP cleaving enzyme 2
  • beta-site APP-cleaving enzyme 2
  • beta-site APP-cleaving enzyme 2, EC 3.4.2310ALP5656 kDa aspartic-like protease
  • CEAP1
  • Down region aspartic protease
  • Down syndrome region aspartic protease
  • DRAPBAE2
  • EC 3.4.23
  • EC 3.4.23.45
  • memapsin-1
  • Membrane-associated aspartic protease 1
  • theta-secretase
  • transmembrane aspartic proteinase Asp1

Background

BACE2 - beta-site APP-cleaving enzyme 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
7954-GM/CF
Species: Hu
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-2278
Species: Hu, Mu
Applications: ICC/IF, IHC
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
9094-AG
Species: Hu

Publications for BACE-2 Partial Recombinant Protein (H00025825-Q01) (0)

There are no publications for BACE-2 Partial Recombinant Protein (H00025825-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BACE-2 Partial Recombinant Protein (H00025825-Q01) (0)

There are no reviews for BACE-2 Partial Recombinant Protein (H00025825-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BACE-2 Partial Recombinant Protein (H00025825-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BACE-2 Products

Bioinformatics Tool for BACE-2 Partial Recombinant Protein (H00025825-Q01)

Discover related pathways, diseases and genes to BACE-2 Partial Recombinant Protein (H00025825-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BACE-2 Partial Recombinant Protein (H00025825-Q01)

Discover more about diseases related to BACE-2 Partial Recombinant Protein (H00025825-Q01).
 

Pathways for BACE-2 Partial Recombinant Protein (H00025825-Q01)

View related products by pathway.

PTMs for BACE-2 Partial Recombinant Protein (H00025825-Q01)

Learn more about PTMs related to BACE-2 Partial Recombinant Protein (H00025825-Q01).
 

Research Areas for BACE-2 Partial Recombinant Protein (H00025825-Q01)

Find related products by research area.

Blogs on BACE-2

There are no specific blogs for BACE-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BACE-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BACE2
Entrez