B3GALTL Antibody

Images

 
Western Blot: B3GALTL Antibody [NBP1-88950] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: B3GALTL Antibody [NBP1-88950] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells and cells in the molecular layer. Cells in the granular layer ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B3GALTL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
B3GALTL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B3GALTL Protein (NBP1-88950PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B3GALTL Antibody

  • B3GALTL
  • B3GLCT
  • B3Glc-T
  • B3GTL
  • B3GTLbeta3Glc-T
  • beta 1,3-galactosyltransferase-like
  • beta 3-glycosyltransferase-like
  • beta-1,3-glucosyltransferase
  • Beta3Glc-T
  • beta-3-glycosyltransferase-like
  • EC 2.4.1.-
  • Gal-T
  • UDP-GAL:beta-GlcNAc beta-1,3-galactosyltransferase-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-92279
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for B3GALTL Antibody (NBP1-88950) (0)

There are no publications for B3GALTL Antibody (NBP1-88950).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALTL Antibody (NBP1-88950) (0)

There are no reviews for B3GALTL Antibody (NBP1-88950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALTL Antibody (NBP1-88950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B3GALTL Products

Bioinformatics Tool for B3GALTL Antibody (NBP1-88950)

Discover related pathways, diseases and genes to B3GALTL Antibody (NBP1-88950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GALTL Antibody (NBP1-88950)

Discover more about diseases related to B3GALTL Antibody (NBP1-88950).
 

Pathways for B3GALTL Antibody (NBP1-88950)

View related products by pathway.

PTMs for B3GALTL Antibody (NBP1-88950)

Learn more about PTMs related to B3GALTL Antibody (NBP1-88950).

Blogs on B3GALTL

There are no specific blogs for B3GALTL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B3GALTL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol B3GALTL
Entrez