B3GALTL Antibody


Western Blot: B3GALTL Antibody [NBP1-69397] - This Anti-B3GALTL antibody was used in Western Blot of SH-SYSY tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related B3GALTL Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

B3GALTL Antibody Summary

Synthetic peptides corresponding to B3GALTL(beta 1,3-galactosyltransferase-like) The peptide sequence was selected from the middle region of B3GALTL. Peptide sequence DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against B3GALTL and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for B3GALTL Antibody

  • B3GLCT
  • B3Glc-T
  • B3GTL
  • B3GTLbeta3Glc-T
  • beta 1,3-galactosyltransferase-like
  • beta 3-glycosyltransferase-like
  • beta-1,3-glucosyltransferase
  • Beta3Glc-T
  • beta-3-glycosyltransferase-like
  • EC 2.4.1.-
  • Gal-T
  • UDP-GAL:beta-GlcNAc beta-1,3-galactosyltransferase-like


B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin (see THBS1; MIM 188060) type-1 repeats (TSRs) of many biologically important proteins. Biosynthesis of glucosyl-beta-1,3-fucose-O- is initiated by protein O-fucosyltransferase-2 (POFUT2; MIM 610249), which attaches the fucosyl residue to a serine or threonine within the TSR. B3GALTL subsequently transfers the glucose onto TSR-fucose (Hess et al., 2008 [PubMed 18199743]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 DN999521.1 41-310 271-457 AB101481.1 161-347 458-467 DN999521.1 499-508 468-1217 AB101481.1 358-1107 1218-1279 DA290408.1 515-576 1280-1607 AB101481.1 1170-1497 1608-2495 AY190526.1 1498-2385 2496-3459 AY190526.1 2387-3350 3460-4071 AV728071.1 87-698 4072-4221 AA769548.1 1-150 c


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB

Publications for B3GALTL Antibody (NBP1-69397) (0)

There are no publications for B3GALTL Antibody (NBP1-69397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B3GALTL Antibody (NBP1-69397) (0)

There are no reviews for B3GALTL Antibody (NBP1-69397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B3GALTL Antibody (NBP1-69397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional B3GALTL Products

Bioinformatics Tool for B3GALTL Antibody (NBP1-69397)

Discover related pathways, diseases and genes to B3GALTL Antibody (NBP1-69397). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B3GALTL Antibody (NBP1-69397)

Discover more about diseases related to B3GALTL Antibody (NBP1-69397).

Pathways for B3GALTL Antibody (NBP1-69397)

View related products by pathway.

PTMs for B3GALTL Antibody (NBP1-69397)

Learn more about PTMs related to B3GALTL Antibody (NBP1-69397).

Blogs on B3GALTL

There are no specific blogs for B3GALTL, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our B3GALTL Antibody and receive a gift card or discount.


Gene Symbol B3GALTL