B-Raf Antibody (3F5)

Images

 
ELISA: B-Raf Antibody (3F5) [H00000673-M08] - Detection limit for recombinant GST tagged BRAF is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related B-Raf Primary Antibodies

Order Details


    • Catalog Number
      H00000673-M08
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

B-Raf Antibody (3F5) Summary

Immunogen
BRAF (NP_004324, 138 a.a. - 231 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVP
Specificity
BRAF (3F5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BRAF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B-Raf Antibody (3F5)

  • 94 kDa B-raf protein
  • B-Raf proto-oncogene serine/threonine-protein kinase (p94)
  • BRaf
  • B-Raf
  • BRAF1
  • B-RAF1
  • BRAF1MGC126806
  • EC 2.7.11.1
  • MGC138284
  • murine sarcoma viral (v-raf) oncogene homolog B1
  • NS7
  • p94
  • Proto-oncogene B-Raf
  • RAFB1
  • serine/threonine-protein kinase B-raf
  • v-raf murine sarcoma viral oncogene homolog B1FLJ95109

Background

This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF482
Species: Mu
Applications: WB, IHC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46403
Species: Hu
Applications: IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP2-43792
Species: Hu
Applications: WB
H00000673-M08
Species: Hu
Applications: WB, ELISA

Publications for B-Raf Antibody (H00000673-M08) (0)

There are no publications for B-Raf Antibody (H00000673-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B-Raf Antibody (H00000673-M08) (0)

There are no reviews for B-Raf Antibody (H00000673-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B-Raf Antibody (H00000673-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B-Raf Products

Bioinformatics Tool for B-Raf Antibody (H00000673-M08)

Discover related pathways, diseases and genes to B-Raf Antibody (H00000673-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B-Raf Antibody (H00000673-M08)

Discover more about diseases related to B-Raf Antibody (H00000673-M08).
 

Pathways for B-Raf Antibody (H00000673-M08)

View related products by pathway.

PTMs for B-Raf Antibody (H00000673-M08)

Learn more about PTMs related to B-Raf Antibody (H00000673-M08).
 

Research Areas for B-Raf Antibody (H00000673-M08)

Find related products by research area.

Blogs on B-Raf.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B-Raf Antibody (3F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol BRAF
Entrez
OMIM
Uniprot