Recombinant Human Axl Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Axl Peptides and Proteins

Order Details


    • Catalog Number
      H00000558-Q03
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Axl Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-99 of Human AXL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGADPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AXL

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Axl Protein

  • Ark
  • AXL oncogene
  • AXL receptor tyrosine kinase
  • AXL transforming sequence/gene
  • Axl
  • EC 2.7.10
  • EC 2.7.10.1
  • JTK11
  • tyrosine-protein kinase receptor UFO
  • Ufo
  • UFOoncogene AXL

Background

The protein encoded by this gene is a member of the receptor tyrosine kinase subfamily. Although it is similar to other receptor tyrosine kinases, this protein represents a unique structure of the extracellular region that juxtaposes IgL and FNIII repeats. It transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6. It is involved in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF885
Species: Hu
Applications: WB, IHC
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Axl Partial Recombinant Protein (H00000558-Q03) (0)

There are no publications for Axl Partial Recombinant Protein (H00000558-Q03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Axl Partial Recombinant Protein (H00000558-Q03) (0)

There are no reviews for Axl Partial Recombinant Protein (H00000558-Q03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Axl Partial Recombinant Protein (H00000558-Q03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Axl Products

Bioinformatics Tool for Axl Partial Recombinant Protein (H00000558-Q03)

Discover related pathways, diseases and genes to Axl Partial Recombinant Protein (H00000558-Q03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axl Partial Recombinant Protein (H00000558-Q03)

Discover more about diseases related to Axl Partial Recombinant Protein (H00000558-Q03).
 

Pathways for Axl Partial Recombinant Protein (H00000558-Q03)

View related products by pathway.

PTMs for Axl Partial Recombinant Protein (H00000558-Q03)

Learn more about PTMs related to Axl Partial Recombinant Protein (H00000558-Q03).
 

Research Areas for Axl Partial Recombinant Protein (H00000558-Q03)

Find related products by research area.

Blogs on Axl

There are no specific blogs for Axl, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Axl Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AXL
Entrez