Axl Antibody


Immunohistochemistry-Paraffin: Axl Antibody [NBP2-38345] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Axl Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSL
Specificity of human Axl antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Axl Knockout HeLa Cell Lysate
Axl Knockout HeLa Cell Lysate
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Axl Antibody

  • ARK
  • AXL oncogene
  • AXL receptor tyrosine kinase
  • AXL transforming sequence/gene
  • Axl
  • EC 2.7.10
  • EC
  • JTK11
  • Tyro7
  • tyrosine-protein kinase receptor UFO
  • UFO
  • UFOoncogene AXL


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Mu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ICC, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for Axl Antibody (NBP2-38345) (0)

There are no publications for Axl Antibody (NBP2-38345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Axl Antibody (NBP2-38345) (0)

There are no reviews for Axl Antibody (NBP2-38345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Axl Antibody (NBP2-38345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Axl Products

Bioinformatics Tool for Axl Antibody (NBP2-38345)

Discover related pathways, diseases and genes to Axl Antibody (NBP2-38345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Axl Antibody (NBP2-38345)

Discover more about diseases related to Axl Antibody (NBP2-38345).

Pathways for Axl Antibody (NBP2-38345)

View related products by pathway.

PTMs for Axl Antibody (NBP2-38345)

Learn more about PTMs related to Axl Antibody (NBP2-38345).

Research Areas for Axl Antibody (NBP2-38345)

Find related products by research area.

Blogs on Axl.

Microglia: pruning shears for homeostatic maintenance in the brain
By Jennifer Sokolowski, MD, PhD.Microglia play a critical role in pruning neurons and synapses during homeostatic maintenance in the adult brain.1 A recent study by Ayata et al. (2018) identified regional differe...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Axl Antibody and receive a gift card or discount.


Gene Symbol AXL