Autoimmune Regulator/AIRE Antibody


Immunohistochemistry-Paraffin: Autoimmune Regulator/AIRE Antibody [NBP1-89046] - Staining of human pancreas shows strong cytoplasmic positivity in intercalated ducts.

Product Details

Product Discontinued
View other related Autoimmune Regulator/AIRE Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Autoimmune Regulator/AIRE Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQ
Specificity of human Autoimmune Regulator/AIRE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (87%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Autoimmune Regulator/AIRE Antibody

  • AIRE
  • APECED protein
  • APS1
  • APSI
  • Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein
  • autoimmune regulator (APECED protein)10APS1AIRE1
  • autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermaldystrophy)
  • Autoimmune Regulator
  • PGA1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, PLA
Species: Hu, Ca
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Pm, Rb
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Autoimmune Regulator/AIRE Antibody (NBP1-89046) (0)

There are no publications for Autoimmune Regulator/AIRE Antibody (NBP1-89046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Autoimmune Regulator/AIRE Antibody (NBP1-89046) (0)

There are no reviews for Autoimmune Regulator/AIRE Antibody (NBP1-89046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Autoimmune Regulator/AIRE Antibody (NBP1-89046). (Showing 1 - 1 of 1 FAQ).

  1. I am looking into a positive control for Western blotting. We are trying to detect the AIRE protein and are not sure whether the antibody we have is picking up the protein. Are you able to tell me whether the human thymus whole tissue lysate (NB820-59456) has been used to detect for AIRE expression by Western blotting?
    • I am not currently aware of any references to the use of our human thymus whole tissue lysate being used to detect AIRE by Western blotting. On looking through the Western blot images for all seven of our AIRE antibodies, I see that these have been generated using lysates from RT-4 cells (bladder), U-251 MG cells (brain), 293 cells (human embryonic kidney), human spleen lysate, liver lysate and tonsil lysate. Additionally, you may find the Human Protein Atlas link to AIRE useful. At this site you can find protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines: The Human Protein Atlas.

Secondary Antibodies


Isotype Controls

Additional Autoimmune Regulator/AIRE Products

Bioinformatics Tool for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Discover related pathways, diseases and genes to Autoimmune Regulator/AIRE Antibody (NBP1-89046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Discover more about diseases related to Autoimmune Regulator/AIRE Antibody (NBP1-89046).

Pathways for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

View related products by pathway.

PTMs for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Learn more about PTMs related to Autoimmune Regulator/AIRE Antibody (NBP1-89046).

Research Areas for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Find related products by research area.

Blogs on Autoimmune Regulator/AIRE

There are no specific blogs for Autoimmune Regulator/AIRE, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Autoimmune Regulator/AIRE Antibody and receive a gift card or discount.


Gene Symbol AIRE