Autoimmune Regulator/AIRE Antibody

Images

 
Immunohistochemistry-Paraffin: Autoimmune Regulator/AIRE Antibody [NBP1-89046] - Staining of human pancreas shows strong cytoplasmic positivity in intercalated ducts.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Autoimmune Regulator/AIRE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AIRE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Autoimmune Regulator/AIRE Protein (NBP1-89046PEP)

Reactivity Notes

Mouse (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Autoimmune Regulator/AIRE Antibody

  • AIRE
  • APECED protein
  • APECED
  • APECEDAPSI
  • APS1
  • APSI
  • Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein
  • autoimmune regulator (APECED protein)10APS1AIRE1
  • autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermaldystrophy)
  • Autoimmune Regulator
  • PGA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
AF9024
Species: Mu, Rt
Applications: WB, IHC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB6487
Species: Hu
Applications: WB, ICC
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13305
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46738
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Autoimmune Regulator/AIRE Antibody (NBP1-89046) (0)

There are no publications for Autoimmune Regulator/AIRE Antibody (NBP1-89046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Autoimmune Regulator/AIRE Antibody (NBP1-89046) (0)

There are no reviews for Autoimmune Regulator/AIRE Antibody (NBP1-89046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Autoimmune Regulator/AIRE Antibody (NBP1-89046). (Showing 1 - 1 of 1 FAQ).

  1. I am looking into a positive control for Western blotting. We are trying to detect the AIRE protein and are not sure whether the antibody we have is picking up the protein. Are you able to tell me whether the human thymus whole tissue lysate (NB820-59456) has been used to detect for AIRE expression by Western blotting?
    • I am not currently aware of any references to the use of our human thymus whole tissue lysate being used to detect AIRE by Western blotting. On looking through the Western blot images for all seven of our AIRE antibodies, I see that these have been generated using lysates from RT-4 cells (bladder), U-251 MG cells (brain), 293 cells (human embryonic kidney), human spleen lysate, liver lysate and tonsil lysate. Additionally, you may find the Human Protein Atlas link to AIRE useful. At this site you can find protein expression profiles based on immunohistochemistry for a large number of human tissues, cancers and cell lines: The Human Protein Atlas.

Secondary Antibodies

 

Isotype Controls

Additional Autoimmune Regulator/AIRE Products

Bioinformatics Tool for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Discover related pathways, diseases and genes to Autoimmune Regulator/AIRE Antibody (NBP1-89046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Discover more about diseases related to Autoimmune Regulator/AIRE Antibody (NBP1-89046).
 

Pathways for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

View related products by pathway.

PTMs for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Learn more about PTMs related to Autoimmune Regulator/AIRE Antibody (NBP1-89046).
 

Research Areas for Autoimmune Regulator/AIRE Antibody (NBP1-89046)

Find related products by research area.

Blogs on Autoimmune Regulator/AIRE

There are no specific blogs for Autoimmune Regulator/AIRE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Autoimmune Regulator/AIRE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIRE
Entrez