ATPB Antibody


Western Blot: ATPB Antibody [NBP1-70415] - This Anti-ATP5B antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry: ATPB Antibody [NBP1-70415] - Titration: 2 ug/ml Positive control: Human brain stem cells.
Immunohistochemistry: ATPB Antibody [NBP1-70415] - NT2 cellsRed: AntibodyBlue: DAPI Primary Dilution: 1ug/50ul Antibody Secondary Antibody: Alexa goat anti-rabbit 594.

Product Details

Product Discontinued
View other related ATPB Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATPB Antibody Summary

Synthetic peptides corresponding to ATP5B(ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide) The peptide sequence was selected from the C terminal of ATP5B. Peptide sequence MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVA
This product is specific to Subunit or Isoform: beta, mitochondrial.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ATP5B and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATPB Antibody

  • ATP synthase subunit beta, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
  • ATPSBmitochondrial ATP synthase beta subunit
  • EC 3.6.3
  • EC
  • MGC5231
  • mitochondrial ATP synthetase, beta subunit


ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, IHC, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF

Publications for ATPB Antibody (NBP1-70415) (0)

There are no publications for ATPB Antibody (NBP1-70415).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATPB Antibody (NBP1-70415) (0)

There are no reviews for ATPB Antibody (NBP1-70415). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATPB Antibody (NBP1-70415) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATPB Products

Bioinformatics Tool for ATPB Antibody (NBP1-70415)

Discover related pathways, diseases and genes to ATPB Antibody (NBP1-70415). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATPB Antibody (NBP1-70415)

Discover more about diseases related to ATPB Antibody (NBP1-70415).

Pathways for ATPB Antibody (NBP1-70415)

View related products by pathway.

PTMs for ATPB Antibody (NBP1-70415)

Learn more about PTMs related to ATPB Antibody (NBP1-70415).

Blogs on ATPB

There are no specific blogs for ATPB, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATPB Antibody and receive a gift card or discount.


Gene Symbol ATP5B