ATP8A1 Antibody

Images

 
Immunohistochemistry: ATP8A1 Antibody [NBP2-30711] - Staining of human breast shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP8A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFCNNHVSTAKYNIITFLPRFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP8A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP8A1 Protein (NBP2-30711PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP8A1 Antibody

  • probable phospholipid-transporting ATPase IA
  • ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1
  • ATPASEII
  • ATPIA
  • ATPP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
46770002
Species: Hu
Applications: ELISA
NBP2-30505
Species: Hu
Applications: IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB5018
Species: Hu
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP2-46477
Species: Hu, Ca
Applications: WB, IHC, IF
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ATP8A1 Antibody (NBP2-30711) (0)

There are no publications for ATP8A1 Antibody (NBP2-30711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP8A1 Antibody (NBP2-30711) (0)

There are no reviews for ATP8A1 Antibody (NBP2-30711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP8A1 Antibody (NBP2-30711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP8A1 Products

Bioinformatics Tool for ATP8A1 Antibody (NBP2-30711)

Discover related pathways, diseases and genes to ATP8A1 Antibody (NBP2-30711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP8A1 Antibody (NBP2-30711)

Discover more about diseases related to ATP8A1 Antibody (NBP2-30711).
 

Pathways for ATP8A1 Antibody (NBP2-30711)

View related products by pathway.

Blogs on ATP8A1

There are no specific blogs for ATP8A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP8A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP8A1
Uniprot