ATP6V1C2 Antibody

Images

 
Immunohistochemistry: ATP6V1C2 Antibody [NBP1-88892] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP6V1C2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REREEMARLLSDKKQQYQTSCVALKKGSSTFPDHKVKVTPLGNPDRPAAGQTDRERESEGEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6V1C2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP6V1C2 Protein (NBP1-88892PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP6V1C2 Antibody

  • ATP6C2
  • ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2
  • ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
  • Vacuolar proton pump subunit C 2
  • V-ATPase C2 subunit
  • V-ATPase subunit C 2
  • VMA5
  • V-type proton ATPase subunit C 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00028299-P01
Species: Hu
AF1936
Species: Hu
Applications: WB, IP
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00580
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88894
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31600
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49059
Species: Hu
Applications: WB, IHC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP1-85668
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88892
Species: Hu
Applications: IHC, IHC-P

Publications for ATP6V1C2 Antibody (NBP1-88892) (0)

There are no publications for ATP6V1C2 Antibody (NBP1-88892).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1C2 Antibody (NBP1-88892) (0)

There are no reviews for ATP6V1C2 Antibody (NBP1-88892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP6V1C2 Antibody (NBP1-88892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP6V1C2 Products

Bioinformatics Tool for ATP6V1C2 Antibody (NBP1-88892)

Discover related pathways, diseases and genes to ATP6V1C2 Antibody (NBP1-88892). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP6V1C2 Antibody (NBP1-88892)

Discover more about diseases related to ATP6V1C2 Antibody (NBP1-88892).
 

Pathways for ATP6V1C2 Antibody (NBP1-88892)

View related products by pathway.

Blogs on ATP6V1C2

There are no specific blogs for ATP6V1C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP6V1C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1C2