ATP5O Antibody



Product Details

Product Discontinued
View other related ATP5O Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATP5O Antibody Summary

Synthetic peptides corresponding to Atp5o (ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit) The peptide sequence was selected from the N terminal of Atp5o. Peptide sequence FSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKEKKLDQVEKEL
This product is specific to Subunit or Isofrom: O, mitochondrial.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against Atp5o and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, B/N, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ATP5O Antibody (NBP1-69024) (0)

There are no publications for ATP5O Antibody (NBP1-69024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5O Antibody (NBP1-69024) (0)

There are no reviews for ATP5O Antibody (NBP1-69024). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for ATP5O Antibody (NBP1-69024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP5O Antibody Products

Related Products by Gene

Bioinformatics Tool for ATP5O Antibody (NBP1-69024)

Discover related pathways, diseases and genes to ATP5O Antibody (NBP1-69024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5O Antibody (NBP1-69024)

Discover more about diseases related to ATP5O Antibody (NBP1-69024).

Pathways for ATP5O Antibody (NBP1-69024)

View related products by pathway.

PTMs for ATP5O Antibody (NBP1-69024)

Learn more about PTMs related to ATP5O Antibody (NBP1-69024).

Blogs on ATP5O

There are no specific blogs for ATP5O, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol ATP5O

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69024 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.