ATP5O Antibody

Images

 
Western Blot: ATP5O Antibody [NBP1-69024] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.

Product Details

Summary
Product Discontinued
View other related ATP5O Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69024
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATP5O Antibody Summary

Immunogen
Synthetic peptides corresponding to Atp5o (ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit) The peptide sequence was selected from the N terminal of Atp5o. Peptide sequence FSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKEKKLDQVEKEL
Specificity
This product is specific to Subunit or Isofrom: O, mitochondrial.
Clonality
Polyclonal
Host
Rabbit
Gene
ATP5O
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Atp5o and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP5O Antibody

  • ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit
  • human ATP synthase OSCP subunit, oligomycin sensitivity conferring protein10ATPOATP synthase subunit O, mitochondrial
  • Oligomycin sensitivity conferral protein
  • oligomycin sensitivity conferring protein
  • OSCPhuman ATP synthase OSCP subunit

Background

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90069
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42805
Species: Hu, Mu, Rt, Po, Bv, Xp, Dr(-)
Applications: WB
NB300-147
Species: Hu, Rt, Po, Bv, Ca, Ha, Rb, Xp, Mu(-)
Applications: WB, ICC/IF, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-88935
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-93442
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2564
Species: Hu
Applications: WB
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ATP5O Antibody (NBP1-69024) (0)

There are no publications for ATP5O Antibody (NBP1-69024).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5O Antibody (NBP1-69024) (0)

There are no reviews for ATP5O Antibody (NBP1-69024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5O Antibody (NBP1-69024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP5O Products

Bioinformatics Tool for ATP5O Antibody (NBP1-69024)

Discover related pathways, diseases and genes to ATP5O Antibody (NBP1-69024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5O Antibody (NBP1-69024)

Discover more about diseases related to ATP5O Antibody (NBP1-69024).
 

Pathways for ATP5O Antibody (NBP1-69024)

View related products by pathway.

PTMs for ATP5O Antibody (NBP1-69024)

Learn more about PTMs related to ATP5O Antibody (NBP1-69024).

Blogs on ATP5O

There are no specific blogs for ATP5O, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP5O Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP5O
Uniprot