ATP5F1 Antibody


Western Blot: ATP5F1 Antibody [NBP1-69010] - Mouse Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related ATP5F1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATP5F1 Antibody Summary

Synthetic peptides corresponding to Atp5f1 (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1) The peptide sequence was selected from the N terminal of Atp5f1. Peptide sequence PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYV
This product is specific to Subunit or Isoform: b, mitochondrial.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Atp5f1 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATP5F1 Antibody

  • ATP synthase B chain, mitochondrial
  • ATP synthase subunit b, mitochondrial
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
  • ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
  • ATPase subunit b
  • cell proliferation-inducing protein 47
  • H+-ATP synthase subunit b
  • MGC24431
  • PIG47


Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC-P, IP, PLA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATP5F1 Antibody (NBP1-69010) (0)

There are no publications for ATP5F1 Antibody (NBP1-69010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP5F1 Antibody (NBP1-69010) (0)

There are no reviews for ATP5F1 Antibody (NBP1-69010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP5F1 Antibody (NBP1-69010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATP5F1 Products

Bioinformatics Tool for ATP5F1 Antibody (NBP1-69010)

Discover related pathways, diseases and genes to ATP5F1 Antibody (NBP1-69010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP5F1 Antibody (NBP1-69010)

Discover more about diseases related to ATP5F1 Antibody (NBP1-69010).

Pathways for ATP5F1 Antibody (NBP1-69010)

View related products by pathway.

Blogs on ATP5F1

There are no specific blogs for ATP5F1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP5F1 Antibody and receive a gift card or discount.


Gene Symbol ATP5F1