ATOX1 Antibody (3B7)


ELISA: ATOX1 Antibody (3B7) [H00000475-M10] - Detection limit for recombinant GST tagged ATOX1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Product Discontinued
View other related ATOX1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATOX1 Antibody (3B7) Summary

ATOX1 (NP_004036, 1 a.a. - 68 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
ATOX1 (3B7)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATOX1 Antibody (3B7)

  • ATX1 (antioxidant protein 1, yeast) homolog 1
  • ATX1 antioxidant protein 1 homolog (yeast)
  • ATX1
  • copper transport protein ATOX1
  • HAH1 MGC138453
  • hah1
  • Metal transport protein ATX1
  • MGC138455


This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATOX1 Antibody (H00000475-M10) (0)

There are no publications for ATOX1 Antibody (H00000475-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATOX1 Antibody (H00000475-M10) (0)

There are no reviews for ATOX1 Antibody (H00000475-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATOX1 Antibody (H00000475-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATOX1 Products

Bioinformatics Tool for ATOX1 Antibody (H00000475-M10)

Discover related pathways, diseases and genes to ATOX1 Antibody (H00000475-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATOX1 Antibody (H00000475-M10)

Discover more about diseases related to ATOX1 Antibody (H00000475-M10).

Pathways for ATOX1 Antibody (H00000475-M10)

View related products by pathway.

PTMs for ATOX1 Antibody (H00000475-M10)

Learn more about PTMs related to ATOX1 Antibody (H00000475-M10).

Research Areas for ATOX1 Antibody (H00000475-M10)

Find related products by research area.

Blogs on ATOX1

There are no specific blogs for ATOX1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATOX1 Antibody (3B7) and receive a gift card or discount.


Gene Symbol ATOX1