Recombinant Human ATG3/APG3 Protein

Product Discontinued

Recombinant Human ATG3/APG3 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-314 of Human ATG3 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: ATG3

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATG3/APG3 Protein

• APG3 autophagy 3-like (S. cerevisiae)
• APG3
• APG3L
• APG3-LIKE
• Apg3p
• ATG3 autophagy related 3 homolog (S. cerevisiae)
• ATG3
• Autophagy-related protein 3
• DKFZp564M1178
• EC 6.3.2.-
• FLJ22125,2610016C12Rik
• hApg3
• MGC15201
• PC3-96
• Protein PC3-96
• ubiquitin-like-conjugating enzyme ATG3

Background

Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATG3