ATG3/APG3 Antibody


Western Blot: ATG3/APG3 Antibody [NBP1-69158] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: ATG3/APG3 Antibody [NBP1-69158] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: ATG3/APG3 Antibody [NBP1-69158] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Product Details

Product Discontinued
View other related ATG3/APG3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATG3/APG3 Antibody Summary

Synthetic peptides corresponding to ATG3 (ATG3 autophagy related 3 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of ATG3. Peptide sequence SDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ATG3 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ATG3/APG3 Antibody

  • APG3 autophagy 3-like (S. cerevisiae)
  • APG3
  • APG3L
  • Apg3p
  • ATG3 autophagy related 3 homolog (S. cerevisiae)
  • ATG3
  • Autophagy-related protein 3
  • DKFZp564M1178
  • EC 6.3.2.-
  • FLJ22125,2610016C12Rik
  • hApg3
  • MGC15201
  • PC3-96
  • Protein PC3-96
  • ubiquitin-like-conjugating enzyme ATG3


Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATG3/APG3 Antibody (NBP1-69158) (0)

There are no publications for ATG3/APG3 Antibody (NBP1-69158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG3/APG3 Antibody (NBP1-69158) (0)

There are no reviews for ATG3/APG3 Antibody (NBP1-69158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG3/APG3 Antibody (NBP1-69158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATG3/APG3 Products

Bioinformatics Tool for ATG3/APG3 Antibody (NBP1-69158)

Discover related pathways, diseases and genes to ATG3/APG3 Antibody (NBP1-69158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG3/APG3 Antibody (NBP1-69158)

Discover more about diseases related to ATG3/APG3 Antibody (NBP1-69158).

Pathways for ATG3/APG3 Antibody (NBP1-69158)

View related products by pathway.

PTMs for ATG3/APG3 Antibody (NBP1-69158)

Learn more about PTMs related to ATG3/APG3 Antibody (NBP1-69158).

Research Areas for ATG3/APG3 Antibody (NBP1-69158)

Find related products by research area.

Blogs on ATG3/APG3

There are no specific blogs for ATG3/APG3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATG3/APG3 Antibody and receive a gift card or discount.


Gene Symbol ATG3