ATF4 Antibody (2B3) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related ATF4 Primary Antibodies

Order Details


    • Catalog Number
      H00000468-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ATF4 Antibody (2B3) [DyLight 488] Summary

Immunogen
ATF4 (NP_001666.2 171 a.a. - 270 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA
Specificity
ATF4 - activating transcription factor 4 (tax-responsive enhancer element B67)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATF4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATF4 Antibody (2B3) [DyLight 488]

  • activating transcription factor 4 (tax-responsive enhancer element B67)
  • Activating transcription factor 4
  • ATF4
  • cAMP-dependent transcription factor ATF-4
  • cAMP-responsive element-binding protein 2
  • CREB-2DNA-binding protein TAXREB67
  • cyclic AMP-dependent transcription factor ATF-4
  • Cyclic AMP-responsive element-binding protein 2
  • TAXREB67
  • TAXREB67CREB2cAMP response element-binding protein 2
  • Tax-responsive enhancer element-binding protein 67
  • TXREB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1543
Species: Hu
Applications: WB, IHC
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01787
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2323
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for ATF4 Antibody (H00000468-M01G) (0)

There are no publications for ATF4 Antibody (H00000468-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF4 Antibody (H00000468-M01G) (0)

There are no reviews for ATF4 Antibody (H00000468-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATF4 Antibody (H00000468-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF4 Products

Bioinformatics Tool for ATF4 Antibody (H00000468-M01G)

Discover related pathways, diseases and genes to ATF4 Antibody (H00000468-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF4 Antibody (H00000468-M01G)

Discover more about diseases related to ATF4 Antibody (H00000468-M01G).
 

Pathways for ATF4 Antibody (H00000468-M01G)

View related products by pathway.

PTMs for ATF4 Antibody (H00000468-M01G)

Learn more about PTMs related to ATF4 Antibody (H00000468-M01G).
 

Research Areas for ATF4 Antibody (H00000468-M01G)

Find related products by research area.

Blogs on ATF4.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.

CENPF Antibodies as Potential Cancer Markers
Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF4 Antibody (2B3) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF4
Entrez